Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 142322..142887 Replicon plasmid unnamed
Accession NZ_CP114587
Organism Salinivibrio kushneri strain TGB4

Toxin (Protein)


Gene name relE Uniprot ID U3BCD3
Locus tag O4598_RS13415 Protein ID WP_010377835.1
Coordinates 142322..142609 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V3HI60
Locus tag O4598_RS13420 Protein ID WP_021024253.1
Coordinates 142606..142887 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4598_RS13390 (O4598_13390) 138096..138806 - 711 WP_028569767.1 LrgB family protein -
O4598_RS13395 (O4598_13395) 138813..139244 - 432 WP_046075946.1 CidA/LrgA family protein -
O4598_RS13400 (O4598_13400) 139600..139923 + 324 WP_269601012.1 helix-turn-helix transcriptional regulator -
O4598_RS13405 (O4598_13405) 139936..141183 + 1248 WP_269601013.1 HipA domain-containing protein -
O4598_RS13410 (O4598_13410) 141282..142181 + 900 WP_269601016.1 LysR family transcriptional regulator -
O4598_RS13415 (O4598_13415) 142322..142609 - 288 WP_010377835.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4598_RS13420 (O4598_13420) 142606..142887 - 282 WP_021024253.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
O4598_RS13425 (O4598_13425) 143202..143530 - 329 Protein_130 transposase -
O4598_RS13430 (O4598_13430) 143735..143977 - 243 WP_069588744.1 type II toxin-antitoxin system ParD family antitoxin -
O4598_RS13435 (O4598_13435) 144140..145021 - 882 WP_269601017.1 metal ABC transporter permease -
O4598_RS13440 (O4598_13440) 145018..145863 - 846 WP_269587869.1 metal ABC transporter permease -
O4598_RS13445 (O4598_13445) 145860..146741 - 882 WP_269601019.1 ATP-binding cassette domain-containing protein -
O4598_RS13450 (O4598_13450) 146728..147585 - 858 WP_235607572.1 metal ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..562514 562514


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10998.68 Da        Isoelectric Point: 4.8177

>T266750 WP_010377835.1 NZ_CP114587:c142609-142322 [Salinivibrio kushneri]
MKVVWSPLALQKLGDAAEFISLDNPPAAEKWVNEVFDKTELLGSMPEMGRFVPEMPNTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQMLSEDDV

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10379.86 Da        Isoelectric Point: 5.7134

>AT266750 WP_021024253.1 NZ_CP114587:c142887-142606 [Salinivibrio kushneri]
MSRIHFDQDIQPLSEFRAGVASYIKQINETRRPLVITQHGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGVSN
DDARAQVLGRIKK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U3BCD3

Antitoxin

Source ID Structure
AlphaFold DB A0A1V3HI60

References