Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
Location | 1659156..1659712 | Replicon | chromosome |
Accession | NZ_CP114586 | ||
Organism | Salinivibrio kushneri strain TGB4 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | O4598_RS07865 | Protein ID | WP_077523282.1 |
Coordinates | 1659156..1659542 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | O4598_RS07870 | Protein ID | WP_077487035.1 |
Coordinates | 1659542..1659712 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4598_RS07835 (O4598_07835) | 1654511..1655452 | - | 942 | WP_077458557.1 | ACP S-malonyltransferase | - |
O4598_RS07840 (O4598_07840) | 1655471..1656430 | - | 960 | WP_069362213.1 | beta-ketoacyl-ACP synthase III | - |
O4598_RS07845 (O4598_07845) | 1656439..1657461 | - | 1023 | WP_069362212.1 | phosphate acyltransferase PlsX | - |
O4598_RS07850 (O4598_07850) | 1657471..1657641 | - | 171 | WP_046075434.1 | 50S ribosomal protein L32 | - |
O4598_RS07855 (O4598_07855) | 1657647..1658177 | - | 531 | WP_069362211.1 | 23S rRNA accumulation protein YceD | - |
O4598_RS07860 (O4598_07860) | 1658503..1659096 | + | 594 | WP_077487031.1 | nucleoside triphosphate pyrophosphatase | - |
O4598_RS07865 (O4598_07865) | 1659156..1659542 | - | 387 | WP_077523282.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
O4598_RS07870 (O4598_07870) | 1659542..1659712 | - | 171 | WP_077487035.1 | acetyltransferase | Antitoxin |
O4598_RS07875 (O4598_07875) | 1659796..1660521 | - | 726 | WP_269599152.1 | HAD-IA family hydrolase | - |
O4598_RS07880 (O4598_07880) | 1660606..1661556 | - | 951 | WP_269599154.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13903.89 Da Isoelectric Point: 3.9499
>T266748 WP_077523282.1 NZ_CP114586:c1659542-1659156 [Salinivibrio kushneri]
MDIICFPFERVIEINAFILASGPGMQGAVDLGKLQGALSRIDNAIIYDGLDDVFEIAAKYTACIAVAHALPDANKRTGLA
VALEYLSLNDFEIVHDNDLLADAVRDLVLGEISELDFADVLYAQYARV
MDIICFPFERVIEINAFILASGPGMQGAVDLGKLQGALSRIDNAIIYDGLDDVFEIAAKYTACIAVAHALPDANKRTGLA
VALEYLSLNDFEIVHDNDLLADAVRDLVLGEISELDFADVLYAQYARV
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|