Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 516677..517236 | Replicon | plasmid unnamed |
| Accession | NZ_CP114585 | ||
| Organism | Salinivibrio proteolyticus strain TGB10 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N7E60_RS16300 | Protein ID | WP_269598676.1 |
| Coordinates | 516958..517236 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1N6J1W2 |
| Locus tag | N7E60_RS16295 | Protein ID | WP_069586513.1 |
| Coordinates | 516677..516958 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E60_RS16260 (N7E60_16260) | 511931..512587 | - | 657 | WP_269598672.1 | peptidase E | - |
| N7E60_RS16265 (N7E60_16265) | 512624..513127 | - | 504 | WP_269598673.1 | AAA family ATPase | - |
| N7E60_RS16270 (N7E60_16270) | 513145..513336 | - | 192 | Protein_449 | GNAT family N-acetyltransferase | - |
| N7E60_RS16275 (N7E60_16275) | 513436..513672 | - | 237 | WP_269598674.1 | hypothetical protein | - |
| N7E60_RS16280 (N7E60_16280) | 513988..515151 | - | 1164 | WP_269598675.1 | cytotoxin | - |
| N7E60_RS16285 (N7E60_16285) | 515875..516153 | - | 279 | WP_077675204.1 | hypothetical protein | - |
| N7E60_RS16290 (N7E60_16290) | 516306..516413 | + | 108 | Protein_453 | IS110 family transposase | - |
| N7E60_RS16295 (N7E60_16295) | 516677..516958 | + | 282 | WP_069586513.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N7E60_RS16300 (N7E60_16300) | 516958..517236 | + | 279 | WP_269598676.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7E60_RS16305 (N7E60_16305) | 517646..518538 | + | 893 | Protein_456 | IS3 family transposase | - |
| N7E60_RS16310 (N7E60_16310) | 518556..519680 | - | 1125 | WP_269597162.1 | ISAs1 family transposase | - |
| N7E60_RS16315 (N7E60_16315) | 519778..520074 | + | 297 | Protein_458 | integrase core domain-containing protein | - |
| N7E60_RS16320 (N7E60_16320) | 520082..520617 | - | 536 | Protein_459 | transposase | - |
| N7E60_RS16325 (N7E60_16325) | 521009..521545 | - | 537 | WP_077641182.1 | hypothetical protein | - |
| N7E60_RS16330 (N7E60_16330) | 521620..522075 | - | 456 | WP_077663549.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hcp-2 / hcp-2 / vipA/mglA / vipB/mglB / VCA0109 / vasA / vasB / vasD / vasE / vasF / clpB/vasG / vasJ / icmF/vasK / hcp-2 | 1..760770 | 760770 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10820.54 Da Isoelectric Point: 4.3135
>T266747 WP_269598676.1 NZ_CP114585:516958-517236 [Salinivibrio proteolyticus]
MILWEEASLNDREKIFEFLYDFNPEVAEKTDSLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIQVM
RVLHQKQKFPTD
MILWEEASLNDREKIFEFLYDFNPEVAEKTDSLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIQVM
RVLHQKQKFPTD
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|