Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 516677..517236 Replicon plasmid unnamed
Accession NZ_CP114585
Organism Salinivibrio proteolyticus strain TGB10

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag N7E60_RS16300 Protein ID WP_269598676.1
Coordinates 516958..517236 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1N6J1W2
Locus tag N7E60_RS16295 Protein ID WP_069586513.1
Coordinates 516677..516958 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E60_RS16260 (N7E60_16260) 511931..512587 - 657 WP_269598672.1 peptidase E -
N7E60_RS16265 (N7E60_16265) 512624..513127 - 504 WP_269598673.1 AAA family ATPase -
N7E60_RS16270 (N7E60_16270) 513145..513336 - 192 Protein_449 GNAT family N-acetyltransferase -
N7E60_RS16275 (N7E60_16275) 513436..513672 - 237 WP_269598674.1 hypothetical protein -
N7E60_RS16280 (N7E60_16280) 513988..515151 - 1164 WP_269598675.1 cytotoxin -
N7E60_RS16285 (N7E60_16285) 515875..516153 - 279 WP_077675204.1 hypothetical protein -
N7E60_RS16290 (N7E60_16290) 516306..516413 + 108 Protein_453 IS110 family transposase -
N7E60_RS16295 (N7E60_16295) 516677..516958 + 282 WP_069586513.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N7E60_RS16300 (N7E60_16300) 516958..517236 + 279 WP_269598676.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7E60_RS16305 (N7E60_16305) 517646..518538 + 893 Protein_456 IS3 family transposase -
N7E60_RS16310 (N7E60_16310) 518556..519680 - 1125 WP_269597162.1 ISAs1 family transposase -
N7E60_RS16315 (N7E60_16315) 519778..520074 + 297 Protein_458 integrase core domain-containing protein -
N7E60_RS16320 (N7E60_16320) 520082..520617 - 536 Protein_459 transposase -
N7E60_RS16325 (N7E60_16325) 521009..521545 - 537 WP_077641182.1 hypothetical protein -
N7E60_RS16330 (N7E60_16330) 521620..522075 - 456 WP_077663549.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hcp-2 / hcp-2 / vipA/mglA / vipB/mglB / VCA0109 / vasA / vasB / vasD / vasE / vasF / clpB/vasG / vasJ / icmF/vasK / hcp-2 1..760770 760770


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-69)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10820.54 Da        Isoelectric Point: 4.3135

>T266747 WP_269598676.1 NZ_CP114585:516958-517236 [Salinivibrio proteolyticus]
MILWEEASLNDREKIFEFLYDFNPEVAEKTDSLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIQVM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10911.20 Da        Isoelectric Point: 8.0533

>AT266747 WP_069586513.1 NZ_CP114585:516677-516958 [Salinivibrio proteolyticus]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKTLSHDAWLTEQVNLAFEKFDSGKSVFVEHQAAQSR
MEERKARIRNRGK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1N6J1W2

References