Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 501825..502470 | Replicon | plasmid unnamed |
Accession | NZ_CP114585 | ||
Organism | Salinivibrio proteolyticus strain TGB10 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | N7E60_RS16205 | Protein ID | WP_069363033.1 |
Coordinates | 502072..502470 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A1V3HTW4 |
Locus tag | N7E60_RS16200 | Protein ID | WP_069363032.1 |
Coordinates | 501825..502058 (+) | Length | 78 a.a. |
Genomic Context
Location: 497259..499706 (2448 bp)
Type: Others
Protein ID: WP_269598666.1
Type: Others
Protein ID: WP_269598666.1
Location: 499715..500686 (972 bp)
Type: Others
Protein ID: WP_077675221.1
Type: Others
Protein ID: WP_077675221.1
Location: 501825..502058 (234 bp)
Type: Antitoxin
Protein ID: WP_069363032.1
Type: Antitoxin
Protein ID: WP_069363032.1
Location: 502072..502470 (399 bp)
Type: Toxin
Protein ID: WP_069363033.1
Type: Toxin
Protein ID: WP_069363033.1
Location: 500679..501098 (420 bp)
Type: Others
Protein ID: WP_167315163.1
Type: Others
Protein ID: WP_167315163.1
Location: 501091..501600 (510 bp)
Type: Others
Protein ID: WP_269598667.1
Type: Others
Protein ID: WP_269598667.1
Location: 502502..502783 (282 bp)
Type: Others
Protein ID: WP_021023566.1
Type: Others
Protein ID: WP_021023566.1
Location: 502911..504359 (1449 bp)
Type: Others
Protein ID: WP_069589412.1
Type: Others
Protein ID: WP_069589412.1
Location: 504371..505096 (726 bp)
Type: Others
Protein ID: WP_269598668.1
Type: Others
Protein ID: WP_269598668.1
Location: 505093..506595 (1503 bp)
Type: Others
Protein ID: WP_077662404.1
Type: Others
Protein ID: WP_077662404.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E60_RS16180 (N7E60_16180) | 497259..499706 | + | 2448 | WP_269598666.1 | DUF2309 domain-containing protein | - |
N7E60_RS16185 (N7E60_16185) | 499715..500686 | + | 972 | WP_077675221.1 | L-threonylcarbamoyladenylate synthase | - |
N7E60_RS16190 (N7E60_16190) | 500679..501098 | - | 420 | WP_167315163.1 | PaaI family thioesterase | - |
N7E60_RS16195 (N7E60_16195) | 501091..501600 | - | 510 | WP_269598667.1 | NifB/NifX family molybdenum-iron cluster-binding protein | - |
N7E60_RS16200 (N7E60_16200) | 501825..502058 | + | 234 | WP_069363032.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N7E60_RS16205 (N7E60_16205) | 502072..502470 | + | 399 | WP_069363033.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N7E60_RS16210 (N7E60_16210) | 502502..502783 | - | 282 | WP_021023566.1 | DUF134 domain-containing protein | - |
N7E60_RS16215 (N7E60_16215) | 502911..504359 | - | 1449 | WP_069589412.1 | decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase | - |
N7E60_RS16220 (N7E60_16220) | 504371..505096 | - | 726 | WP_269598668.1 | 6-phosphogluconolactonase | - |
N7E60_RS16225 (N7E60_16225) | 505093..506595 | - | 1503 | WP_077662404.1 | glucose-6-phosphate dehydrogenase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hcp-2 / hcp-2 / vipA/mglA / vipB/mglB / VCA0109 / vasA / vasB / vasD / vasE / vasF / clpB/vasG / vasJ / icmF/vasK / hcp-2 | 1..760770 | 760770 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14542.95 Da Isoelectric Point: 8.7410
>T266746 WP_069363033.1 NZ_CP114585:502072-502470 [Salinivibrio proteolyticus]
MLDTCICSFIMREQPKAVLKKLHTVVGNQHRIVISAITYQEMQYGLLGKKASPKHAVLVDAFLQRIDEILPWDKAAVDAT
TAVKRNLMNKGTPIGGNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWA
MLDTCICSFIMREQPKAVLKKLHTVVGNQHRIVISAITYQEMQYGLLGKKASPKHAVLVDAFLQRIDEILPWDKAAVDAT
TAVKRNLMNKGTPIGGNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLEDWA
Download Length: 399 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3HTW4 |