Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 261340..261905 Replicon plasmid unnamed
Accession NZ_CP114585
Organism Salinivibrio proteolyticus strain TGB10

Toxin (Protein)


Gene name relE Uniprot ID U3BCD3
Locus tag N7E60_RS15125 Protein ID WP_010377835.1
Coordinates 261340..261627 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V3HI60
Locus tag N7E60_RS15130 Protein ID WP_021024253.1
Coordinates 261624..261905 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E60_RS15100 (N7E60_15100) 257043..257687 - 645 WP_077639985.1 pyroglutamyl-peptidase I -
N7E60_RS15105 (N7E60_15105) 257762..258901 - 1140 WP_269598948.1 peptide-methionine (R)-S-oxide reductase MsrB -
N7E60_RS15110 (N7E60_15110) 259022..259732 - 711 WP_077608514.1 LrgB family protein -
N7E60_RS15115 (N7E60_15115) 259739..260170 - 432 WP_167315444.1 CidA/LrgA family protein -
N7E60_RS15120 (N7E60_15120) 260300..261199 + 900 WP_077669852.1 LysR family transcriptional regulator -
N7E60_RS15125 (N7E60_15125) 261340..261627 - 288 WP_010377835.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7E60_RS15130 (N7E60_15130) 261624..261905 - 282 WP_021024253.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7E60_RS15135 (N7E60_15135) 262003..262425 - 423 WP_269598949.1 hypothetical protein -
N7E60_RS15140 (N7E60_15140) 262910..263191 + 282 Protein_223 LysR substrate-binding domain-containing protein -
N7E60_RS15145 (N7E60_15145) 263280..264077 - 798 WP_046075942.1 hypothetical protein -
N7E60_RS15150 (N7E60_15150) 264575..265345 - 771 WP_096631753.1 hypothetical protein -
N7E60_RS15155 (N7E60_15155) 265459..266328 - 870 WP_269598950.1 restriction endonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hcp-2 / hcp-2 / vipA/mglA / vipB/mglB / VCA0109 / vasA / vasB / vasD / vasE / vasF / clpB/vasG / vasJ / icmF/vasK / hcp-2 1..760770 760770


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10998.68 Da        Isoelectric Point: 4.8177

>T266745 WP_010377835.1 NZ_CP114585:c261627-261340 [Salinivibrio proteolyticus]
MKVVWSPLALQKLGDAAEFISLDNPPAAEKWVNEVFDKTELLGSMPEMGRFVPEMPNTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQMLSEDDV

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10379.86 Da        Isoelectric Point: 5.7134

>AT266745 WP_021024253.1 NZ_CP114585:c261905-261624 [Salinivibrio proteolyticus]
MSRIHFDQDIQPLSEFRAGVASYIKQINETRRPLVITQHGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGVSN
DDARAQVLGRIKK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U3BCD3

Antitoxin

Source ID Structure
AlphaFold DB A0A1V3HI60

References