Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 1586502..1587064 | Replicon | chromosome |
| Accession | NZ_CP114584 | ||
| Organism | Salinivibrio proteolyticus strain TGB10 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | N7E60_RS07530 | Protein ID | WP_269596996.1 |
| Coordinates | 1586502..1586819 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | N7E60_RS07535 | Protein ID | WP_269596997.1 |
| Coordinates | 1586816..1587064 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E60_RS07520 (N7E60_07520) | 1581920..1585366 | - | 3447 | WP_269596993.1 | type I-F CRISPR-associated helicase Cas3f | - |
| N7E60_RS07525 (N7E60_07525) | 1585363..1586334 | - | 972 | WP_269596995.1 | type I-F CRISPR-associated endonuclease Cas1f | - |
| N7E60_RS07530 (N7E60_07530) | 1586502..1586819 | - | 318 | WP_269596996.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7E60_RS07535 (N7E60_07535) | 1586816..1587064 | - | 249 | WP_269596997.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| N7E60_RS07540 (N7E60_07540) | 1587986..1588270 | + | 285 | WP_069587016.1 | TIGR03643 family protein | - |
| N7E60_RS07545 (N7E60_07545) | 1588592..1589755 | - | 1164 | WP_269596998.1 | amidase family protein | - |
| N7E60_RS07550 (N7E60_07550) | 1589877..1591043 | - | 1167 | WP_269596999.1 | DnaJ domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12479.35 Da Isoelectric Point: 10.4982
>T266744 WP_269596996.1 NZ_CP114584:c1586819-1586502 [Salinivibrio proteolyticus]
MTASQIKKQVRITPRARDDLKNIGRYTERKWGKAQRNTYLKRLATRFNWLAENPQLGQHRTDIENGYYCFPEGQHLVFYL
IRRHAIDIIGVPHKEMDIINHFTIG
MTASQIKKQVRITPRARDDLKNIGRYTERKWGKAQRNTYLKRLATRFNWLAENPQLGQHRTDIENGYYCFPEGQHLVFYL
IRRHAIDIIGVPHKEMDIINHFTIG
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|