Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
Location | 1190367..1190883 | Replicon | chromosome |
Accession | NZ_CP114584 | ||
Organism | Salinivibrio proteolyticus strain TGB10 |
Toxin (Protein)
Gene name | relB | Uniprot ID | A0A1V3HGW7 |
Locus tag | N7E60_RS05760 | Protein ID | WP_025744833.1 |
Coordinates | 1190620..1190883 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | N7E60_RS05755 | Protein ID | WP_269598351.1 |
Coordinates | 1190367..1190627 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E60_RS05715 (N7E60_05715) | 1185636..1185905 | - | 270 | Protein_1086 | IS110 family transposase | - |
N7E60_RS05720 (N7E60_05720) | 1185936..1186277 | + | 342 | WP_269598346.1 | GNAT family N-acetyltransferase | - |
N7E60_RS05725 (N7E60_05725) | 1186249..1187045 | + | 797 | WP_269597063.1 | IS5 family transposase | - |
N7E60_RS05730 (N7E60_05730) | 1187118..1187273 | + | 156 | WP_269598347.1 | GNAT family N-acetyltransferase | - |
N7E60_RS05735 (N7E60_05735) | 1187435..1188385 | + | 951 | WP_269598348.1 | prolyl aminopeptidase | - |
N7E60_RS05740 (N7E60_05740) | 1188747..1189085 | + | 339 | WP_269598349.1 | hypothetical protein | - |
N7E60_RS05745 (N7E60_05745) | 1189141..1189689 | + | 549 | WP_096627911.1 | GNAT family protein | - |
N7E60_RS05750 (N7E60_05750) | 1189711..1190208 | + | 498 | WP_269598350.1 | ASCH domain-containing protein | - |
N7E60_RS05755 (N7E60_05755) | 1190367..1190627 | + | 261 | WP_269598351.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
N7E60_RS05760 (N7E60_05760) | 1190620..1190883 | + | 264 | WP_025744833.1 | Txe/YoeB family addiction module toxin | Toxin |
N7E60_RS05765 (N7E60_05765) | 1191231..1191626 | + | 396 | WP_269598352.1 | hypothetical protein | - |
N7E60_RS05770 (N7E60_05770) | 1191697..1192095 | - | 399 | WP_069590096.1 | acyl-CoA thioester hydrolase YciA | - |
N7E60_RS05775 (N7E60_05775) | 1192189..1192731 | - | 543 | WP_077640746.1 | septation protein A | - |
N7E60_RS05780 (N7E60_05780) | 1192882..1194225 | - | 1344 | WP_069590100.1 | sodium-dependent transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10446.91 Da Isoelectric Point: 9.0258
>T266743 WP_025744833.1 NZ_CP114584:1190620-1190883 [Salinivibrio proteolyticus]
MSSRLLCWTDDAWRDYVYWQSQDRKTLKRINKLILDVKRTPFEGIGKPEALKENLTGFWSRRIDDTNRLVYAVDDTSITI
LSCRYHY
MSSRLLCWTDDAWRDYVYWQSQDRKTLKRINKLILDVKRTPFEGIGKPEALKENLTGFWSRRIDDTNRLVYAVDDTSITI
LSCRYHY
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|