Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 940475..941019 | Replicon | chromosome |
Accession | NZ_CP114584 | ||
Organism | Salinivibrio proteolyticus strain TGB10 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1V3HA63 |
Locus tag | N7E60_RS04610 | Protein ID | WP_021024563.1 |
Coordinates | 940720..941019 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1V3HAB7 |
Locus tag | N7E60_RS04605 | Protein ID | WP_025744793.1 |
Coordinates | 940475..940732 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E60_RS04590 (N7E60_04590) | 935752..938901 | + | 3150 | WP_269598238.1 | multidrug efflux RND transporter permease subunit | - |
N7E60_RS04595 (N7E60_04595) | 938984..939679 | - | 696 | WP_077640455.1 | 7-cyano-7-deazaguanine synthase QueC | - |
N7E60_RS04600 (N7E60_04600) | 939861..940385 | + | 525 | WP_269598239.1 | RES family NAD+ phosphorylase | - |
N7E60_RS04605 (N7E60_04605) | 940475..940732 | + | 258 | WP_025744793.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N7E60_RS04610 (N7E60_04610) | 940720..941019 | + | 300 | WP_021024563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E60_RS04615 (N7E60_04615) | 941095..941529 | - | 435 | WP_231637397.1 | thioesterase family protein | - |
N7E60_RS04620 (N7E60_04620) | 941773..943155 | + | 1383 | WP_269598240.1 | ATP-dependent RNA helicase DbpA | - |
N7E60_RS04625 (N7E60_04625) | 943195..944019 | + | 825 | WP_269598241.1 | phosphotransferase | - |
N7E60_RS04630 (N7E60_04630) | 944099..944593 | + | 495 | WP_269598242.1 | DUF1003 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11335.15 Da Isoelectric Point: 4.5994
>T266742 WP_021024563.1 NZ_CP114584:940720-941019 [Salinivibrio proteolyticus]
MAQIVWTEPALADLNDVAEYVALDNLVAAKALVQAAFTAVERLVLFPDSGRVPPELPHLNYREVVVNPCRIFYKQEEDTV
FILFVMRSEQDLRKFLLSR
MAQIVWTEPALADLNDVAEYVALDNLVAAKALVQAAFTAVERLVLFPDSGRVPPELPHLNYREVVVNPCRIFYKQEEDTV
FILFVMRSEQDLRKFLLSR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3HA63 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3HAB7 |