Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3483412..3483949 | Replicon | chromosome |
Accession | NZ_CP114576 | ||
Organism | Legionella pneumophila strain H3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LpnH3D14_RS15760 | Protein ID | WP_042234319.1 |
Coordinates | 3483412..3483708 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LpnH3D14_RS15765 | Protein ID | WP_027266056.1 |
Coordinates | 3483698..3483949 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LpnH3D14_RS15735 (LpnH3D14_03170) | 3479622..3480515 | - | 894 | WP_042234326.1 | hypothetical protein | - |
LpnH3D14_RS15740 (LpnH3D14_03171) | 3480783..3480974 | + | 192 | WP_011947807.1 | hypothetical protein | - |
LpnH3D14_RS15745 | 3481121..3481225 | - | 105 | Protein_3092 | lytic murein transglycosylase | - |
LpnH3D14_RS15750 (LpnH3D14_03172) | 3481319..3482482 | - | 1164 | WP_014842907.1 | tetratricopeptide repeat protein | - |
LpnH3D14_RS15755 (LpnH3D14_03173) | 3482841..3483323 | - | 483 | WP_014842908.1 | hypothetical protein | - |
LpnH3D14_RS15760 (LpnH3D14_03174) | 3483412..3483708 | - | 297 | WP_042234319.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LpnH3D14_RS15765 (LpnH3D14_03175) | 3483698..3483949 | - | 252 | WP_027266056.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
LpnH3D14_RS15770 | 3484037..3484237 | - | 201 | WP_236708780.1 | hypothetical protein | - |
LpnH3D14_RS15775 (LpnH3D14_03177) | 3484815..3485954 | - | 1140 | WP_129317146.1 | DUF3800 domain-containing protein | - |
LpnH3D14_RS15780 (LpnH3D14_03178) | 3486072..3486629 | - | 558 | WP_129317147.1 | recombinase family protein | - |
LpnH3D14_RS15785 | 3486717..3486857 | + | 141 | WP_154231193.1 | hypothetical protein | - |
LpnH3D14_RS15790 (LpnH3D14_03179) | 3486882..3487385 | - | 504 | WP_042234312.1 | hypothetical protein | - |
LpnH3D14_RS15795 (LpnH3D14_03180) | 3487495..3488541 | - | 1047 | WP_027219936.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11424.29 Da Isoelectric Point: 10.5027
>T266738 WP_042234319.1 NZ_CP114576:c3483708-3483412 [Legionella pneumophila]
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASAGLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYGDADNRQEDS
MIYELHFHPLALKEWKKLGKNLQEEFKKVLKRRLENPHVASAGLRGSLKNCYKIKLRQSGYRLVYQVNDNKLIVTVIAVG
KRNKNVVYGDADNRQEDS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|