Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 175634..176160 | Replicon | plasmid pE1532-MCR |
Accession | NZ_CP114574 | ||
Organism | Enterobacter hormaechei strain E1532 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | O2601_RS25255 | Protein ID | WP_000323025.1 |
Coordinates | 175873..176160 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | O2601_RS25250 | Protein ID | WP_000534858.1 |
Coordinates | 175634..175873 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2601_RS25230 (O2601_25230) | 171962..173200 | + | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
O2601_RS25235 (O2601_25235) | 173676..174248 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
O2601_RS25240 (O2601_25240) | 174448..175371 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
O2601_RS25245 (O2601_25245) | 175505..175609 | - | 105 | Protein_187 | protein YdfV | - |
O2601_RS25250 (O2601_25250) | 175634..175873 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
O2601_RS25255 (O2601_25255) | 175873..176160 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
O2601_RS25260 (O2601_25260) | 176232..176390 | + | 159 | WP_001447866.1 | type I toxin-antitoxin system Hok family toxin | - |
O2601_RS25265 (O2601_25265) | 176999..177319 | - | 321 | WP_000332796.1 | hypothetical protein | - |
O2601_RS25270 (O2601_25270) | 177601..177804 | - | 204 | WP_001015183.1 | hypothetical protein | - |
O2601_RS25275 (O2601_25275) | 177851..178201 | - | 351 | WP_000743059.1 | hypothetical protein | - |
O2601_RS25280 (O2601_25280) | 178261..178863 | - | 603 | WP_012695474.1 | hypothetical protein | - |
O2601_RS25285 (O2601_25285) | 178959..179903 | - | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
O2601_RS25290 (O2601_25290) | 180414..180590 | + | 177 | WP_001371930.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / qnrB4 / blaDHA-1 / sul1 / blaSHV-12 / aac(3)-IId / mph(A) / aph(3')-Ia / mcr-9 / aph(6)-Id / aph(3'')-Ib | - | 1..308217 | 308217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T266735 WP_000323025.1 NZ_CP114574:175873-176160 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|