Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 35250..35893 | Replicon | plasmid pE1532-KPC |
| Accession | NZ_CP114573 | ||
| Organism | Enterobacter hormaechei strain E1532 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | O2601_RS24275 | Protein ID | WP_000754566.1 |
| Coordinates | 35250..35666 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | O2601_RS24280 | Protein ID | WP_001261276.1 |
| Coordinates | 35663..35893 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2601_RS24255 (O2601_24255) | 32081..32626 | + | 546 | WP_001493763.1 | plasmid pRiA4b ORF-3 family protein | - |
| O2601_RS24260 (O2601_24260) | 32763..33335 | + | 573 | WP_001493762.1 | recombinase family protein | - |
| O2601_RS24265 (O2601_24265) | 33372..34763 | + | 1392 | WP_014839878.1 | ISKra4-like element ISKpn19 family transposase | - |
| O2601_RS24270 (O2601_24270) | 34795..35046 | - | 252 | Protein_33 | transposase | - |
| O2601_RS24275 (O2601_24275) | 35250..35666 | - | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O2601_RS24280 (O2601_24280) | 35663..35893 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O2601_RS24285 (O2601_24285) | 36467..36817 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| O2601_RS24290 (O2601_24290) | 36868..37611 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| O2601_RS24295 (O2601_24295) | 37608..38384 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| O2601_RS24300 (O2601_24300) | 38442..38699 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| O2601_RS24305 (O2601_24305) | 38828..38932 | - | 105 | WP_032409716.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(A) / blaKPC-2 | - | 1..39461 | 39461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T266733 WP_000754566.1 NZ_CP114573:c35666-35250 [Enterobacter hormaechei]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |