Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 4786251..4786867 | Replicon | chromosome |
| Accession | NZ_CP114571 | ||
| Organism | Enterobacter hormaechei strain E1532 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O2601_RS23305 | Protein ID | WP_015569913.1 |
| Coordinates | 4786251..4786622 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | O2601_RS23310 | Protein ID | WP_015569912.1 |
| Coordinates | 4786625..4786867 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2601_RS23290 (O2601_23290) | 4783751..4784653 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| O2601_RS23295 (O2601_23295) | 4784650..4785285 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| O2601_RS23300 (O2601_23300) | 4785282..4786211 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| O2601_RS23305 (O2601_23305) | 4786251..4786622 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
| O2601_RS23310 (O2601_23310) | 4786625..4786867 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| O2601_RS23315 (O2601_23315) | 4787066..4787986 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
| O2601_RS23320 (O2601_23320) | 4787995..4788936 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| O2601_RS23325 (O2601_23325) | 4788981..4789418 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| O2601_RS23330 (O2601_23330) | 4789415..4790296 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| O2601_RS23335 (O2601_23335) | 4790290..4790889 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| O2601_RS23340 (O2601_23340) | 4791008..4791808 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T266732 WP_015569913.1 NZ_CP114571:c4786622-4786251 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|