Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3875432..3876089 | Replicon | chromosome |
Accession | NZ_CP114571 | ||
Organism | Enterobacter hormaechei strain E1532 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | O2601_RS18900 | Protein ID | WP_017382887.1 |
Coordinates | 3875432..3875842 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | O2601_RS18905 | Protein ID | WP_003863437.1 |
Coordinates | 3875823..3876089 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2601_RS18880 (O2601_18880) | 3871430..3873163 | - | 1734 | WP_023304383.1 | single-stranded-DNA-specific exonuclease RecJ | - |
O2601_RS18885 (O2601_18885) | 3873169..3873882 | - | 714 | WP_023295380.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
O2601_RS18890 (O2601_18890) | 3873911..3874807 | - | 897 | WP_023304385.1 | site-specific tyrosine recombinase XerD | - |
O2601_RS18895 (O2601_18895) | 3874909..3875430 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
O2601_RS18900 (O2601_18900) | 3875432..3875842 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
O2601_RS18905 (O2601_18905) | 3875823..3876089 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
O2601_RS18910 (O2601_18910) | 3876384..3877364 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
O2601_RS18915 (O2601_18915) | 3877476..3878135 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
O2601_RS18920 (O2601_18920) | 3878402..3879133 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
O2601_RS18925 (O2601_18925) | 3879250..3880683 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T266731 WP_017382887.1 NZ_CP114571:c3875842-3875432 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |