Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2864716..2865321 Replicon chromosome
Accession NZ_CP114571
Organism Enterobacter hormaechei strain E1532

Toxin (Protein)


Gene name hicA Uniprot ID D2TUP9
Locus tag O2601_RS13875 Protein ID WP_012906750.1
Coordinates 2864716..2864895 (+) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A822X3T2
Locus tag O2601_RS13880 Protein ID WP_032619507.1
Coordinates 2864917..2865321 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O2601_RS13845 (O2601_13845) 2860045..2860761 + 717 WP_032619512.1 ABC transporter ATP-binding protein -
O2601_RS13850 (O2601_13850) 2860927..2861397 + 471 WP_017384432.1 hypothetical protein -
O2601_RS13855 (O2601_13855) 2861403..2862329 - 927 WP_032619511.1 LysR substrate-binding domain-containing protein -
O2601_RS13860 (O2601_13860) 2862359..2862682 - 324 WP_017384434.1 hypothetical protein -
O2601_RS13865 (O2601_13865) 2862685..2863032 - 348 WP_230199855.1 DUF4225 domain-containing protein -
O2601_RS13870 (O2601_13870) 2863099..2863440 - 342 WP_223862348.1 DUF4225 domain-containing protein -
O2601_RS13875 (O2601_13875) 2864716..2864895 + 180 WP_012906750.1 type II toxin-antitoxin system HicA family toxin Toxin
O2601_RS13880 (O2601_13880) 2864917..2865321 + 405 WP_032619507.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
O2601_RS13885 (O2601_13885) 2865362..2866432 - 1071 WP_032635096.1 glycosyltransferase family 9 protein -
O2601_RS13890 (O2601_13890) 2866509..2867087 - 579 WP_032619505.1 tail fiber assembly protein -
O2601_RS13895 (O2601_13895) 2867087..2869264 - 2178 WP_058670599.1 phage tail protein -
O2601_RS13900 (O2601_13900) 2869267..2869818 - 552 WP_032619504.1 phage tail protein I -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - fliA 2860057..2971795 111738


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6644.85 Da        Isoelectric Point: 10.9132

>T266728 WP_012906750.1 NZ_CP114571:2864716-2864895 [Enterobacter hormaechei]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14676.53 Da        Isoelectric Point: 4.2136

>AT266728 WP_032619507.1 NZ_CP114571:2864917-2865321 [Enterobacter hormaechei]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGEDYQDAIESVREAIEAHIELLVEDGESVPEATTVENWLSDPEYAGAVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVINQR

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6XDK4

Antitoxin

Source ID Structure
AlphaFold DB A0A822X3T2

References