Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2390628..2391367 | Replicon | chromosome |
| Accession | NZ_CP114571 | ||
| Organism | Enterobacter hormaechei strain E1532 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A822W909 |
| Locus tag | O2601_RS11635 | Protein ID | WP_017382345.1 |
| Coordinates | 2390628..2391113 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | O2601_RS11640 | Protein ID | WP_003857131.1 |
| Coordinates | 2391101..2391367 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2601_RS11610 (O2601_11610) | 2386115..2387083 | - | 969 | WP_013815099.1 | IS5-like element IS903B family transposase | - |
| O2601_RS11615 (O2601_11615) | 2387115..2387486 | - | 372 | Protein_2268 | transposase | - |
| O2601_RS11620 (O2601_11620) | 2387561..2388193 | + | 633 | WP_001567369.1 | hypothetical protein | - |
| O2601_RS11625 (O2601_11625) | 2388222..2389625 | - | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| O2601_RS11630 (O2601_11630) | 2390008..2390577 | + | 570 | WP_017382346.1 | hypothetical protein | - |
| O2601_RS11635 (O2601_11635) | 2390628..2391113 | - | 486 | WP_017382345.1 | GNAT family N-acetyltransferase | Toxin |
| O2601_RS11640 (O2601_11640) | 2391101..2391367 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| O2601_RS11645 (O2601_11645) | 2391431..2392360 | - | 930 | WP_023303744.1 | LysR family transcriptional regulator | - |
| O2601_RS11650 (O2601_11650) | 2392490..2393878 | + | 1389 | WP_032619651.1 | MFS transporter | - |
| O2601_RS11655 (O2601_11655) | 2393900..2394895 | - | 996 | WP_023303746.1 | DUF2891 domain-containing protein | - |
| O2601_RS11660 (O2601_11660) | 2394905..2395891 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | aph(3')-Ia | - | 2378977..2391367 | 12390 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17510.21 Da Isoelectric Point: 9.9658
>T266723 WP_017382345.1 NZ_CP114571:c2391113-2390628 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822W909 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |