Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2624861..2625460 | Replicon | chromosome |
Accession | NZ_CP114551 | ||
Organism | Xylella fastidiosa subsp. pauca strain OLI17A |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O4443_RS11945 | Protein ID | WP_228762756.1 |
Coordinates | 2625173..2625460 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9P9V8 |
Locus tag | O4443_RS11940 | Protein ID | WP_010895177.1 |
Coordinates | 2624861..2625169 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4443_RS11905 (O4443_11905) | 2621445..2622206 | - | 762 | WP_010895174.1 | Bax inhibitor-1/YccA family protein | - |
O4443_RS11930 (O4443_11930) | 2623007..2623201 | + | 195 | WP_069107173.1 | hypothetical protein | - |
O4443_RS11935 (O4443_11935) | 2623401..2624795 | + | 1395 | WP_109161026.1 | hypothetical protein | - |
O4443_RS11940 (O4443_11940) | 2624861..2625169 | - | 309 | WP_010895177.1 | putative addiction module antidote protein | Antitoxin |
O4443_RS11945 (O4443_11945) | 2625173..2625460 | - | 288 | WP_228762756.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4443_RS11950 (O4443_11950) | 2625556..2626326 | + | 771 | WP_010895179.1 | hypothetical protein | - |
O4443_RS11955 (O4443_11955) | 2626326..2626592 | + | 267 | WP_023907141.1 | hypothetical protein | - |
O4443_RS11960 (O4443_11960) | 2627051..2627444 | - | 394 | Protein_2333 | DUF596 domain-containing protein | - |
O4443_RS11965 (O4443_11965) | 2627456..2627758 | - | 303 | Protein_2334 | DUF769 domain-containing protein | - |
O4443_RS11970 (O4443_11970) | 2627984..2628367 | - | 384 | WP_031338086.1 | DUF596 domain-containing protein | - |
O4443_RS11975 (O4443_11975) | 2628379..2628720 | - | 342 | Protein_2336 | DUF769 domain-containing protein | - |
O4443_RS11980 (O4443_11980) | 2628880..2629272 | - | 393 | WP_167701479.1 | DUF596 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2623401..2626592 | 3191 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10939.63 Da Isoelectric Point: 10.3074
>T266720 WP_228762756.1 NZ_CP114551:c2625460-2625173 [Xylella fastidiosa subsp. pauca]
VKRLEEFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDKSTQQ
SDIRRAIELAKSLED
VKRLEEFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDKSTQQ
SDIRRAIELAKSLED
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|