Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 1699506..1700037 | Replicon | chromosome |
Accession | NZ_CP114551 | ||
Organism | Xylella fastidiosa subsp. pauca strain OLI17A |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1L2ALG3 |
Locus tag | O4443_RS07985 | Protein ID | WP_060872142.1 |
Coordinates | 1699506..1699787 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A1L2ALQ3 |
Locus tag | O4443_RS07990 | Protein ID | WP_060872141.1 |
Coordinates | 1699774..1700037 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4443_RS07955 (O4443_07955) | 1695359..1697239 | + | 1881 | WP_088372102.1 | phage major capsid protein | - |
O4443_RS07960 (O4443_07960) | 1697257..1697517 | + | 261 | WP_060872391.1 | hypothetical protein | - |
O4443_RS07965 (O4443_07965) | 1697517..1697840 | + | 324 | WP_042462902.1 | hypothetical protein | - |
O4443_RS07970 (O4443_07970) | 1697837..1698358 | + | 522 | WP_010893241.1 | hypothetical protein | - |
O4443_RS07975 (O4443_07975) | 1698334..1698876 | + | 543 | WP_023907873.1 | hypothetical protein | - |
O4443_RS07980 (O4443_07980) | 1698873..1699460 | + | 588 | WP_031336754.1 | phage baseplate assembly protein V | - |
O4443_RS07985 (O4443_07985) | 1699506..1699787 | - | 282 | WP_060872142.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
O4443_RS07990 (O4443_07990) | 1699774..1700037 | - | 264 | WP_060872141.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
O4443_RS07995 (O4443_07995) | 1700202..1700525 | + | 324 | WP_282454360.1 | GPW/gp25 family protein | - |
O4443_RS08000 (O4443_08000) | 1700525..1701418 | + | 894 | WP_282454361.1 | baseplate J/gp47 family protein | - |
O4443_RS08005 (O4443_08005) | 1701411..1701968 | + | 558 | WP_031336758.1 | phage tail protein I | - |
O4443_RS08010 (O4443_08010) | 1701976..1703568 | + | 1593 | WP_282454362.1 | hypothetical protein | - |
O4443_RS08015 (O4443_08015) | 1703633..1704811 | + | 1179 | WP_282454363.1 | phage tail sheath family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1668636..1713653 | 45017 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10873.32 Da Isoelectric Point: 7.5805
>T266718 WP_060872142.1 NZ_CP114551:c1699787-1699506 [Xylella fastidiosa subsp. pauca]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVVHALACDHPLEPRHHDHALTGSWKDHRDCHIKPDLVLIYRKPDDETL
QLVRIGSHSELGL
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVVHALACDHPLEPRHHDHALTGSWKDHRDCHIKPDLVLIYRKPDDETL
QLVRIGSHSELGL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1L2ALG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1L2ALQ3 |