Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1413718..1414246 Replicon chromosome
Accession NZ_CP114551
Organism Xylella fastidiosa subsp. pauca strain OLI17A

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag O4443_RS06675 Protein ID WP_010894533.1
Coordinates 1413718..1413999 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID Q9PBQ9
Locus tag O4443_RS06680 Protein ID WP_010894534.1
Coordinates 1413986..1414246 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4443_RS06630 (O4443_06630) 1408838..1408945 - 108 WP_257000796.1 hypothetical protein -
O4443_RS06635 (O4443_06635) 1409009..1409272 - 264 WP_023906433.1 hypothetical protein -
O4443_RS06640 (O4443_06640) 1409837..1410022 - 186 WP_010894523.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4443_RS06645 (O4443_06645) 1410015..1410257 - 243 WP_010894524.1 type II toxin-antitoxin system ParD family antitoxin -
O4443_RS06650 (O4443_06650) 1410914..1411210 - 297 WP_010894527.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4443_RS06655 (O4443_06655) 1411198..1411476 - 279 WP_010894528.1 CopG family ribbon-helix-helix protein -
O4443_RS06660 (O4443_06660) 1412259..1412918 + 660 WP_010894530.1 hypothetical protein -
O4443_RS06665 (O4443_06665) 1412938..1413300 + 363 WP_143704175.1 hypothetical protein -
O4443_RS06670 (O4443_06670) 1413411..1413665 + 255 Protein_1302 conjugal transfer protein TrbJ -
O4443_RS06675 (O4443_06675) 1413718..1413999 - 282 WP_010894533.1 type II toxin-antitoxin system YafQ family toxin Toxin
O4443_RS06680 (O4443_06680) 1413986..1414246 - 261 WP_010894534.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O4443_RS06685 (O4443_06685) 1414576..1415382 - 807 WP_010894535.1 oxidoreductase -
O4443_RS06690 (O4443_06690) 1415428..1418490 - 3063 WP_010894536.1 efflux RND transporter permease subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-68)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10727.49 Da        Isoelectric Point: 9.0869

>T266717 WP_010894533.1 NZ_CP114551:c1413999-1413718 [Xylella fastidiosa subsp. pauca]
VREIKQLGQFKRDLKREAKGQHRATLEDDLLPVIDALAKDMPLEPRHRDHALLGNWKDLRDCHIKLDLVLIYTRVDSKTL
TLVRLGSHAELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 8997.58 Da        Isoelectric Point: 10.5972

>AT266717 WP_010894534.1 NZ_CP114551:c1414246-1413986 [Xylella fastidiosa subsp. pauca]
MAANQLVQARIDGAIKAEATVVLAAMGLTISDAVRLLLTKVAQDKALPFEPLIPNATTIKAMREARAGKGETVTLGELRA
TIRAGN

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q9PBQ9

References