Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 1410914..1411476 Replicon chromosome
Accession NZ_CP114551
Organism Xylella fastidiosa subsp. pauca strain OLI17A

Toxin (Protein)


Gene name parE Uniprot ID Q9PBR6
Locus tag O4443_RS06650 Protein ID WP_010894527.1
Coordinates 1410914..1411210 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9PBR5
Locus tag O4443_RS06655 Protein ID WP_010894528.1
Coordinates 1411198..1411476 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4443_RS06595 (O4443_06595) 1405992..1406201 + 210 WP_010894516.1 hypothetical protein -
O4443_RS06600 (O4443_06600) 1406231..1406766 - 536 Protein_1288 recombinase family protein -
O4443_RS06605 (O4443_06605) 1406760..1406963 - 204 WP_023906434.1 hypothetical protein -
O4443_RS06610 (O4443_06610) 1407015..1407284 - 270 WP_010894518.1 hypothetical protein -
O4443_RS06615 (O4443_06615) 1407393..1407701 - 309 WP_010894519.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4443_RS06620 (O4443_06620) 1407705..1407977 - 273 WP_010894520.1 hypothetical protein -
O4443_RS06625 (O4443_06625) 1407974..1408429 - 456 WP_010894521.1 hypothetical protein -
O4443_RS06630 (O4443_06630) 1408838..1408945 - 108 WP_257000796.1 hypothetical protein -
O4443_RS06635 (O4443_06635) 1409009..1409272 - 264 WP_023906433.1 hypothetical protein -
O4443_RS06640 (O4443_06640) 1409837..1410022 - 186 WP_010894523.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4443_RS06645 (O4443_06645) 1410015..1410257 - 243 WP_010894524.1 type II toxin-antitoxin system ParD family antitoxin -
O4443_RS06650 (O4443_06650) 1410914..1411210 - 297 WP_010894527.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4443_RS06655 (O4443_06655) 1411198..1411476 - 279 WP_010894528.1 CopG family ribbon-helix-helix protein Antitoxin
O4443_RS06660 (O4443_06660) 1412259..1412918 + 660 WP_010894530.1 hypothetical protein -
O4443_RS06665 (O4443_06665) 1412938..1413300 + 363 WP_143704175.1 hypothetical protein -
O4443_RS06670 (O4443_06670) 1413411..1413665 + 255 Protein_1302 conjugal transfer protein TrbJ -
O4443_RS06675 (O4443_06675) 1413718..1413999 - 282 WP_010894533.1 type II toxin-antitoxin system YafQ family toxin -
O4443_RS06680 (O4443_06680) 1413986..1414246 - 261 WP_010894534.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
O4443_RS06685 (O4443_06685) 1414576..1415382 - 807 WP_010894535.1 oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-94)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11155.72 Da        Isoelectric Point: 7.4670

>T266716 WP_010894527.1 NZ_CP114551:c1411210-1410914 [Xylella fastidiosa subsp. pauca]
MPRVIFAPEAILNIQRLRNFLHPKNTDAARRAGEAIMRGARMLGAQPHIGRPVDDMPDEYREWLIDFGDSGYVARYHIDG
DTVTILAVRHHKEVGYTS

Download         Length: 297 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10772.08 Da        Isoelectric Point: 5.6126

>AT266716 WP_010894528.1 NZ_CP114551:c1411476-1411198 [Xylella fastidiosa subsp. pauca]
MGMATSIKLDDELKGRVQHLADVRRRTSHWIMREAIAQYVEREEKRETFRQDTLKAWEEFQATGLHVTTEEVEKWLSSWG
TENELSAPVCHG

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1S0VAK4

Antitoxin

Source ID Structure
AlphaFold DB A0A1S0V821

References