Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 1410914..1411476 | Replicon | chromosome |
| Accession | NZ_CP114551 | ||
| Organism | Xylella fastidiosa subsp. pauca strain OLI17A | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q9PBR6 |
| Locus tag | O4443_RS06650 | Protein ID | WP_010894527.1 |
| Coordinates | 1410914..1411210 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9PBR5 |
| Locus tag | O4443_RS06655 | Protein ID | WP_010894528.1 |
| Coordinates | 1411198..1411476 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4443_RS06595 (O4443_06595) | 1405992..1406201 | + | 210 | WP_010894516.1 | hypothetical protein | - |
| O4443_RS06600 (O4443_06600) | 1406231..1406766 | - | 536 | Protein_1288 | recombinase family protein | - |
| O4443_RS06605 (O4443_06605) | 1406760..1406963 | - | 204 | WP_023906434.1 | hypothetical protein | - |
| O4443_RS06610 (O4443_06610) | 1407015..1407284 | - | 270 | WP_010894518.1 | hypothetical protein | - |
| O4443_RS06615 (O4443_06615) | 1407393..1407701 | - | 309 | WP_010894519.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O4443_RS06620 (O4443_06620) | 1407705..1407977 | - | 273 | WP_010894520.1 | hypothetical protein | - |
| O4443_RS06625 (O4443_06625) | 1407974..1408429 | - | 456 | WP_010894521.1 | hypothetical protein | - |
| O4443_RS06630 (O4443_06630) | 1408838..1408945 | - | 108 | WP_257000796.1 | hypothetical protein | - |
| O4443_RS06635 (O4443_06635) | 1409009..1409272 | - | 264 | WP_023906433.1 | hypothetical protein | - |
| O4443_RS06640 (O4443_06640) | 1409837..1410022 | - | 186 | WP_010894523.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O4443_RS06645 (O4443_06645) | 1410015..1410257 | - | 243 | WP_010894524.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| O4443_RS06650 (O4443_06650) | 1410914..1411210 | - | 297 | WP_010894527.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O4443_RS06655 (O4443_06655) | 1411198..1411476 | - | 279 | WP_010894528.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| O4443_RS06660 (O4443_06660) | 1412259..1412918 | + | 660 | WP_010894530.1 | hypothetical protein | - |
| O4443_RS06665 (O4443_06665) | 1412938..1413300 | + | 363 | WP_143704175.1 | hypothetical protein | - |
| O4443_RS06670 (O4443_06670) | 1413411..1413665 | + | 255 | Protein_1302 | conjugal transfer protein TrbJ | - |
| O4443_RS06675 (O4443_06675) | 1413718..1413999 | - | 282 | WP_010894533.1 | type II toxin-antitoxin system YafQ family toxin | - |
| O4443_RS06680 (O4443_06680) | 1413986..1414246 | - | 261 | WP_010894534.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| O4443_RS06685 (O4443_06685) | 1414576..1415382 | - | 807 | WP_010894535.1 | oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11155.72 Da Isoelectric Point: 7.4670
>T266716 WP_010894527.1 NZ_CP114551:c1411210-1410914 [Xylella fastidiosa subsp. pauca]
MPRVIFAPEAILNIQRLRNFLHPKNTDAARRAGEAIMRGARMLGAQPHIGRPVDDMPDEYREWLIDFGDSGYVARYHIDG
DTVTILAVRHHKEVGYTS
MPRVIFAPEAILNIQRLRNFLHPKNTDAARRAGEAIMRGARMLGAQPHIGRPVDDMPDEYREWLIDFGDSGYVARYHIDG
DTVTILAVRHHKEVGYTS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S0VAK4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S0V821 |