266714

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1217747..1218233 Replicon chromosome
Accession NZ_CP114551
Organism Xylella fastidiosa subsp. pauca strain OLI17A

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag O4443_RS05645 Protein ID WP_060871810.1
Coordinates 1217747..1218022 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A1L2AR28
Locus tag O4443_RS05650 Protein ID WP_031336679.1
Coordinates 1218006..1218233 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4443_RS05615 (O4443_05615) 1213898..1214335 + 438 WP_023907683.1 DUF3277 family protein -
O4443_RS05620 (O4443_05620) 1214332..1214754 + 423 WP_023907971.1 putative phage tail assembly chaperone -
O4443_RS05625 (O4443_05625) 1214902..1216791 + 1890 WP_088371571.1 hypothetical protein -
O4443_RS05630 (O4443_05630) 1217121..1217297 + 177 WP_088371569.1 Blp family class II bacteriocin -
O4443_RS05635 (O4443_05635) 1217331..1217519 + 189 WP_088371567.1 hypothetical protein -
O4443_RS05640 (O4443_05640) 1217524..1217694 - 171 WP_088372206.1 antitoxin -
O4443_RS05645 (O4443_05645) 1217747..1218022 - 276 WP_060871810.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4443_RS05650 (O4443_05650) 1218006..1218233 - 228 WP_031336679.1 DUF6290 family protein Antitoxin
O4443_RS05655 (O4443_05655) 1218342..1219112 + 771 WP_088371565.1 hypothetical protein -
O4443_RS05660 (O4443_05660) 1219112..1219429 + 318 WP_010894089.1 hypothetical protein -
O4443_RS05665 (O4443_05665) 1219426..1220256 + 831 WP_088371563.1 hypothetical protein -
O4443_RS05670 (O4443_05670) 1220253..1220894 + 642 WP_088371561.1 Gp138 family membrane-puncturing spike protein -
O4443_RS05675 (O4443_05675) 1220891..1221244 + 354 WP_088372030.1 hypothetical protein -
O4443_RS05680 (O4443_05680) 1221255..1221560 - 306 WP_060872107.1 putative addiction module antidote protein -
O4443_RS05685 (O4443_05685) 1221557..1221859 - 303 WP_060872108.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4443_RS05690 (O4443_05690) 1221958..1223103 + 1146 WP_088371559.1 baseplate J/gp47 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1182636..1230498 47862


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10552.23 Da        Isoelectric Point: 10.3419

>T266714 WP_060871810.1 NZ_CP114551:c1218022-1217747 [Xylella fastidiosa subsp. pauca]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC

Download         Length: 276 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8691.73 Da        Isoelectric Point: 5.0958

>AT266714 WP_031336679.1 NZ_CP114551:c1218233-1218006 [Xylella fastidiosa subsp. pauca]
MATSIRLSPEMEQRLNYLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1L2AR28

References