Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasB-vapB/RelE-VagC |
| Location | 1217524..1218022 | Replicon | chromosome |
| Accession | NZ_CP114551 | ||
| Organism | Xylella fastidiosa subsp. pauca strain OLI17A | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | - |
| Locus tag | O4443_RS05645 | Protein ID | WP_060871810.1 |
| Coordinates | 1217747..1218022 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | O4443_RS05640 | Protein ID | WP_088372206.1 |
| Coordinates | 1217524..1217694 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4443_RS05615 (O4443_05615) | 1213898..1214335 | + | 438 | WP_023907683.1 | DUF3277 family protein | - |
| O4443_RS05620 (O4443_05620) | 1214332..1214754 | + | 423 | WP_023907971.1 | putative phage tail assembly chaperone | - |
| O4443_RS05625 (O4443_05625) | 1214902..1216791 | + | 1890 | WP_088371571.1 | hypothetical protein | - |
| O4443_RS05630 (O4443_05630) | 1217121..1217297 | + | 177 | WP_088371569.1 | Blp family class II bacteriocin | - |
| O4443_RS05635 (O4443_05635) | 1217331..1217519 | + | 189 | WP_088371567.1 | hypothetical protein | - |
| O4443_RS05640 (O4443_05640) | 1217524..1217694 | - | 171 | WP_088372206.1 | antitoxin | Antitoxin |
| O4443_RS05645 (O4443_05645) | 1217747..1218022 | - | 276 | WP_060871810.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O4443_RS05650 (O4443_05650) | 1218006..1218233 | - | 228 | WP_031336679.1 | DUF6290 family protein | - |
| O4443_RS05655 (O4443_05655) | 1218342..1219112 | + | 771 | WP_088371565.1 | hypothetical protein | - |
| O4443_RS05660 (O4443_05660) | 1219112..1219429 | + | 318 | WP_010894089.1 | hypothetical protein | - |
| O4443_RS05665 (O4443_05665) | 1219426..1220256 | + | 831 | WP_088371563.1 | hypothetical protein | - |
| O4443_RS05670 (O4443_05670) | 1220253..1220894 | + | 642 | WP_088371561.1 | Gp138 family membrane-puncturing spike protein | - |
| O4443_RS05675 (O4443_05675) | 1220891..1221244 | + | 354 | WP_088372030.1 | hypothetical protein | - |
| O4443_RS05680 (O4443_05680) | 1221255..1221560 | - | 306 | WP_060872107.1 | putative addiction module antidote protein | - |
| O4443_RS05685 (O4443_05685) | 1221557..1221859 | - | 303 | WP_060872108.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1182636..1230498 | 47862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10552.23 Da Isoelectric Point: 10.3419
>T266713 WP_060871810.1 NZ_CP114551:c1218022-1217747 [Xylella fastidiosa subsp. pauca]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|