Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
Location | 1192421..1193217 | Replicon | chromosome |
Accession | NZ_CP114551 | ||
Organism | Xylella fastidiosa subsp. pauca strain OLI17A |
Toxin (Protein)
Gene name | VbhT | Uniprot ID | - |
Locus tag | O4443_RS05445 | Protein ID | WP_023907999.1 |
Coordinates | 1192606..1193217 (+) | Length | 204 a.a. |
Antitoxin (Protein)
Gene name | VbhA | Uniprot ID | A0A060HF63 |
Locus tag | O4443_RS05440 | Protein ID | WP_004087046.1 |
Coordinates | 1192421..1192609 (+) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4443_RS05405 (O4443_05405) | 1188905..1189831 | - | 927 | WP_088371969.1 | phage recombination protein Bet | - |
O4443_RS05410 (O4443_05410) | 1189847..1190005 | - | 159 | WP_282454502.1 | hypothetical protein | - |
O4443_RS05415 (O4443_05415) | 1190026..1190217 | - | 192 | WP_088371617.1 | hypothetical protein | - |
O4443_RS05420 (O4443_05420) | 1190241..1190432 | - | 192 | WP_010894147.1 | hypothetical protein | - |
O4443_RS05425 (O4443_05425) | 1190429..1190836 | - | 408 | WP_088371615.1 | hypothetical protein | - |
O4443_RS05430 (O4443_05430) | 1190836..1191294 | - | 459 | WP_023908001.1 | hypothetical protein | - |
O4443_RS05435 (O4443_05435) | 1191291..1192019 | - | 729 | WP_023908000.1 | hypothetical protein | - |
O4443_RS05440 (O4443_05440) | 1192421..1192609 | + | 189 | WP_004087046.1 | antitoxin VbhA family protein | Antitoxin |
O4443_RS05445 (O4443_05445) | 1192606..1193217 | + | 612 | WP_023907999.1 | Fic/DOC family protein | Toxin |
O4443_RS05450 (O4443_05450) | 1193268..1193969 | - | 702 | WP_282454503.1 | helix-turn-helix transcriptional regulator | - |
O4443_RS05455 (O4443_05455) | 1194046..1194291 | + | 246 | WP_088371611.1 | hypothetical protein | - |
O4443_RS05460 (O4443_05460) | 1194471..1194860 | - | 390 | WP_088371609.1 | hypothetical protein | - |
O4443_RS05465 (O4443_05465) | 1194988..1195176 | + | 189 | WP_282454504.1 | hypothetical protein | - |
O4443_RS05470 (O4443_05470) | 1195206..1195421 | + | 216 | WP_282454349.1 | hypothetical protein | - |
O4443_RS05475 (O4443_05475) | 1195418..1195801 | + | 384 | WP_282454505.1 | hypothetical protein | - |
O4443_RS05480 (O4443_05480) | 1196005..1197117 | + | 1113 | WP_282454524.1 | Bro-N domain-containing protein | - |
O4443_RS05485 (O4443_05485) | 1197114..1197404 | + | 291 | Protein_1067 | DUF1376 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1182636..1230498 | 47862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 204 a.a. Molecular weight: 22919.68 Da Isoelectric Point: 4.9434
>T266712 WP_023907999.1 NZ_CP114551:1192606-1193217 [Xylella fastidiosa subsp. pauca]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE
Download Length: 612 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|