Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1192421..1193217 Replicon chromosome
Accession NZ_CP114551
Organism Xylella fastidiosa subsp. pauca strain OLI17A

Toxin (Protein)


Gene name VbhT Uniprot ID -
Locus tag O4443_RS05445 Protein ID WP_023907999.1
Coordinates 1192606..1193217 (+) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID A0A060HF63
Locus tag O4443_RS05440 Protein ID WP_004087046.1
Coordinates 1192421..1192609 (+) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4443_RS05405 (O4443_05405) 1188905..1189831 - 927 WP_088371969.1 phage recombination protein Bet -
O4443_RS05410 (O4443_05410) 1189847..1190005 - 159 WP_282454502.1 hypothetical protein -
O4443_RS05415 (O4443_05415) 1190026..1190217 - 192 WP_088371617.1 hypothetical protein -
O4443_RS05420 (O4443_05420) 1190241..1190432 - 192 WP_010894147.1 hypothetical protein -
O4443_RS05425 (O4443_05425) 1190429..1190836 - 408 WP_088371615.1 hypothetical protein -
O4443_RS05430 (O4443_05430) 1190836..1191294 - 459 WP_023908001.1 hypothetical protein -
O4443_RS05435 (O4443_05435) 1191291..1192019 - 729 WP_023908000.1 hypothetical protein -
O4443_RS05440 (O4443_05440) 1192421..1192609 + 189 WP_004087046.1 antitoxin VbhA family protein Antitoxin
O4443_RS05445 (O4443_05445) 1192606..1193217 + 612 WP_023907999.1 Fic/DOC family protein Toxin
O4443_RS05450 (O4443_05450) 1193268..1193969 - 702 WP_282454503.1 helix-turn-helix transcriptional regulator -
O4443_RS05455 (O4443_05455) 1194046..1194291 + 246 WP_088371611.1 hypothetical protein -
O4443_RS05460 (O4443_05460) 1194471..1194860 - 390 WP_088371609.1 hypothetical protein -
O4443_RS05465 (O4443_05465) 1194988..1195176 + 189 WP_282454504.1 hypothetical protein -
O4443_RS05470 (O4443_05470) 1195206..1195421 + 216 WP_282454349.1 hypothetical protein -
O4443_RS05475 (O4443_05475) 1195418..1195801 + 384 WP_282454505.1 hypothetical protein -
O4443_RS05480 (O4443_05480) 1196005..1197117 + 1113 WP_282454524.1 Bro-N domain-containing protein -
O4443_RS05485 (O4443_05485) 1197114..1197404 + 291 Protein_1067 DUF1376 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1182636..1230498 47862


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22919.68 Da        Isoelectric Point: 4.9434

>T266712 WP_023907999.1 NZ_CP114551:1192606-1193217 [Xylella fastidiosa subsp. pauca]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6855.80 Da        Isoelectric Point: 4.9859

>AT266712 WP_004087046.1 NZ_CP114551:1192421-1192609 [Xylella fastidiosa subsp. pauca]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQMA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A060HF63

References