266711

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-dnstrm_HI1420
Location 1015309..1015901 Replicon chromosome
Accession NZ_CP114551
Organism Xylella fastidiosa subsp. pauca strain OLI17A

Toxin (Protein)


Gene name PumA Uniprot ID Q9PD07
Locus tag O4443_RS04540 Protein ID WP_010894094.1
Coordinates 1015605..1015901 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag O4443_RS04535 Protein ID WP_004085592.1
Coordinates 1015309..1015602 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4443_RS04485 (O4443_04485) 1011130..1011306 + 177 WP_088371569.1 Blp family class II bacteriocin -
O4443_RS04490 (O4443_04490) 1011340..1011528 + 189 WP_088371567.1 hypothetical protein -
O4443_RS04495 (O4443_04495) 1011533..1011703 - 171 WP_088372206.1 antitoxin -
O4443_RS04500 (O4443_04500) 1011756..1012031 - 276 WP_060871810.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4443_RS04505 (O4443_04505) 1012015..1012242 - 228 WP_031336679.1 DUF6290 family protein -
O4443_RS04510 (O4443_04510) 1012351..1013121 + 771 WP_088371565.1 hypothetical protein -
O4443_RS04515 (O4443_04515) 1013121..1013438 + 318 WP_010894089.1 hypothetical protein -
O4443_RS04520 (O4443_04520) 1013435..1014265 + 831 WP_088371563.1 hypothetical protein -
O4443_RS04525 (O4443_04525) 1014262..1014903 + 642 WP_088371561.1 Gp138 family membrane-puncturing spike protein -
O4443_RS04530 (O4443_04530) 1014900..1015253 + 354 WP_088372030.1 hypothetical protein -
O4443_RS04535 (O4443_04535) 1015309..1015602 - 294 WP_004085592.1 putative addiction module antidote protein Antitoxin
O4443_RS04540 (O4443_04540) 1015605..1015901 - 297 WP_010894094.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4443_RS04545 (O4443_04545) 1016096..1016302 - 207 WP_171817075.1 hypothetical protein -
O4443_RS04550 (O4443_04550) 1016502..1016948 - 447 WP_031336674.1 hypothetical protein -
O4443_RS04555 (O4443_04555) 1017190..1018167 - 978 WP_023906642.1 hypothetical protein -
O4443_RS04560 (O4443_04560) 1018164..1019039 - 876 WP_023906641.1 ABC transporter ATP-binding protein -
O4443_RS04565 (O4443_04565) 1019258..1019419 + 162 WP_010894100.1 hypothetical protein -
O4443_RS04570 (O4443_04570) 1019785..1020357 + 573 WP_282454493.1 glutathione peroxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 987252..1015901 28649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-94)

Antitoxin

Uncharacterized protein HI1420

(3-93)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11167.73 Da        Isoelectric Point: 9.8173

>T266711 WP_010894094.1 NZ_CP114551:c1015901-1015605 [Xylella fastidiosa subsp. pauca]
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQQRGDTIYLLLCGGDKG
LQARDIKTALHLSEQWSE

Download         Length: 297 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10246.59 Da        Isoelectric Point: 5.6232

>AT266711 WP_004085592.1 NZ_CP114551:c1015602-1015309 [Xylella fastidiosa subsp. pauca]
MTEKLTSYDPAEDLTTDQAIADFMAAAFGTNDPAYVAHALGVVARAKGMTQIASQTGLSREQLYRSFSAEGNPTLRTTLA
VMKALGIELSAKPSGVH

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1S0V711

Antitoxin

Source ID Structure

References