266709

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasB-vapB/RelE-VagC
Location 1011533..1012031 Replicon chromosome
Accession NZ_CP114551
Organism Xylella fastidiosa subsp. pauca strain OLI17A

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag O4443_RS04500 Protein ID WP_060871810.1
Coordinates 1011756..1012031 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag O4443_RS04495 Protein ID WP_088372206.1
Coordinates 1011533..1011703 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4443_RS04470 (O4443_04470) 1007907..1008344 + 438 WP_023907683.1 DUF3277 family protein -
O4443_RS04475 (O4443_04475) 1008341..1008763 + 423 WP_023907971.1 putative phage tail assembly chaperone -
O4443_RS04480 (O4443_04480) 1008911..1010800 + 1890 WP_088371571.1 hypothetical protein -
O4443_RS04485 (O4443_04485) 1011130..1011306 + 177 WP_088371569.1 Blp family class II bacteriocin -
O4443_RS04490 (O4443_04490) 1011340..1011528 + 189 WP_088371567.1 hypothetical protein -
O4443_RS04495 (O4443_04495) 1011533..1011703 - 171 WP_088372206.1 antitoxin Antitoxin
O4443_RS04500 (O4443_04500) 1011756..1012031 - 276 WP_060871810.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4443_RS04505 (O4443_04505) 1012015..1012242 - 228 WP_031336679.1 DUF6290 family protein -
O4443_RS04510 (O4443_04510) 1012351..1013121 + 771 WP_088371565.1 hypothetical protein -
O4443_RS04515 (O4443_04515) 1013121..1013438 + 318 WP_010894089.1 hypothetical protein -
O4443_RS04520 (O4443_04520) 1013435..1014265 + 831 WP_088371563.1 hypothetical protein -
O4443_RS04525 (O4443_04525) 1014262..1014903 + 642 WP_088371561.1 Gp138 family membrane-puncturing spike protein -
O4443_RS04530 (O4443_04530) 1014900..1015253 + 354 WP_088372030.1 hypothetical protein -
O4443_RS04535 (O4443_04535) 1015309..1015602 - 294 WP_004085592.1 putative addiction module antidote protein -
O4443_RS04540 (O4443_04540) 1015605..1015901 - 297 WP_010894094.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4443_RS04545 (O4443_04545) 1016096..1016302 - 207 WP_171817075.1 hypothetical protein -
O4443_RS04550 (O4443_04550) 1016502..1016948 - 447 WP_031336674.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 987252..1015901 28649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

SpoVT-AbrB domain

(16-54)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10552.23 Da        Isoelectric Point: 10.3419

>T266709 WP_060871810.1 NZ_CP114551:c1012031-1011756 [Xylella fastidiosa subsp. pauca]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC

Download         Length: 276 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6537.59 Da        Isoelectric Point: 10.4580

>AT266709 WP_088372206.1 NZ_CP114551:c1011703-1011533 [Xylella fastidiosa subsp. pauca]
MPISSPLSRTKEAKLFRNNRSQVVRIPVEFELPGDRVLIHREEDKLIIEPITRPTN

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References