Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2636821..2637420 | Replicon | chromosome |
| Accession | NZ_CP114550 | ||
| Organism | Xylella fastidiosa subsp. pauca strain AM2-Angelina | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | O4445_RS12125 | Protein ID | WP_228762756.1 |
| Coordinates | 2637133..2637420 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9P9V8 |
| Locus tag | O4445_RS12120 | Protein ID | WP_010895177.1 |
| Coordinates | 2636821..2637129 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4445_RS12085 (O4445_12085) | 2633405..2634166 | - | 762 | WP_010895174.1 | Bax inhibitor-1/YccA family protein | - |
| O4445_RS12110 (O4445_12110) | 2634967..2635161 | + | 195 | WP_069107173.1 | hypothetical protein | - |
| O4445_RS12115 (O4445_12115) | 2635361..2636755 | + | 1395 | WP_109161026.1 | hypothetical protein | - |
| O4445_RS12120 (O4445_12120) | 2636821..2637129 | - | 309 | WP_010895177.1 | putative addiction module antidote protein | Antitoxin |
| O4445_RS12125 (O4445_12125) | 2637133..2637420 | - | 288 | WP_228762756.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O4445_RS12130 (O4445_12130) | 2637516..2638286 | + | 771 | WP_010895179.1 | hypothetical protein | - |
| O4445_RS12135 (O4445_12135) | 2638286..2638552 | + | 267 | WP_023907141.1 | hypothetical protein | - |
| O4445_RS12140 (O4445_12140) | 2639011..2639404 | - | 394 | Protein_2369 | DUF596 domain-containing protein | - |
| O4445_RS12145 (O4445_12145) | 2639416..2639670 | - | 255 | WP_010895183.1 | hemagglutinin | - |
| O4445_RS12150 (O4445_12150) | 2639944..2640327 | - | 384 | WP_031338086.1 | DUF596 domain-containing protein | - |
| O4445_RS12155 (O4445_12155) | 2640339..2640641 | - | 303 | WP_152527175.1 | DUF769 domain-containing protein | - |
| O4445_RS12160 (O4445_12160) | 2640840..2641232 | - | 393 | WP_167701479.1 | DUF596 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2635361..2638552 | 3191 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10939.63 Da Isoelectric Point: 10.3074
>T266708 WP_228762756.1 NZ_CP114550:c2637420-2637133 [Xylella fastidiosa subsp. pauca]
VKRLEEFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDKSTQQ
SDIRRAIELAKSLED
VKRLEEFSDWLKGLKDGLARQRLIKRLRKVQLGNFGDVQPVGEGVFEMREHFGPGWRMYYVQRGSFLIVMLGGGDKSTQQ
SDIRRAIELAKSLED
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|