Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 1843205..1843746 | Replicon | chromosome |
Accession | NZ_CP114550 | ||
Organism | Xylella fastidiosa subsp. pauca strain AM2-Angelina |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | O4445_RS08685 | Protein ID | WP_282454387.1 |
Coordinates | 1843205..1843528 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q9PCB8 |
Locus tag | O4445_RS08690 | Protein ID | WP_010894329.1 |
Coordinates | 1843525..1843746 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4445_RS08655 (O4445_08655) | 1839119..1839526 | + | 408 | WP_088371303.1 | DUF4124 domain-containing protein | - |
O4445_RS08660 (O4445_08660) | 1839552..1839785 | - | 234 | WP_058569894.1 | hypothetical protein | - |
O4445_RS08665 (O4445_08665) | 1840047..1840877 | + | 831 | WP_282454383.1 | site-specific integrase | - |
O4445_RS08670 (O4445_08670) | 1840858..1841310 | - | 453 | WP_282454384.1 | DUF3693 domain-containing protein | - |
O4445_RS08675 (O4445_08675) | 1841441..1842622 | + | 1182 | WP_282454385.1 | replication initiation factor domain-containing protein | - |
O4445_RS08680 (O4445_08680) | 1842609..1842932 | + | 324 | WP_282454386.1 | hypothetical protein | - |
O4445_RS08685 (O4445_08685) | 1843205..1843528 | - | 324 | WP_282454387.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
O4445_RS08690 (O4445_08690) | 1843525..1843746 | - | 222 | WP_010894329.1 | antitoxin MazE family protein | Antitoxin |
O4445_RS08695 (O4445_08695) | 1844406..1845248 | - | 843 | WP_228762888.1 | methylisocitrate lyase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1839839..1843840 | 4001 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11743.79 Da Isoelectric Point: 7.9831
>T266706 WP_282454387.1 NZ_CP114550:c1843528-1843205 [Xylella fastidiosa subsp. pauca]
MIQRGDLVTVSLQGDYGKPRPALIVQSDLLTELDSVALCPVTSDLRNAIFRVTVEPTAANGLRTLSQVMVDKISTLPRNK
ISEPFGRLNDEKMKAIERALLLIIGII
MIQRGDLVTVSLQGDYGKPRPALIVQSDLLTELDSVALCPVTSDLRNAIFRVTVEPTAANGLRTLSQVMVDKISTLPRNK
ISEPFGRLNDEKMKAIERALLLIIGII
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|