Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 1698718..1699249 | Replicon | chromosome |
| Accession | NZ_CP114550 | ||
| Organism | Xylella fastidiosa subsp. pauca strain AM2-Angelina | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1L2ALG3 |
| Locus tag | O4445_RS08005 | Protein ID | WP_060872142.1 |
| Coordinates | 1698718..1698999 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A0A1L2ALQ3 |
| Locus tag | O4445_RS08010 | Protein ID | WP_060872141.1 |
| Coordinates | 1698986..1699249 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4445_RS07975 (O4445_07975) | 1694571..1696451 | + | 1881 | WP_088372102.1 | phage major capsid protein | - |
| O4445_RS07980 (O4445_07980) | 1696469..1696729 | + | 261 | WP_060872391.1 | hypothetical protein | - |
| O4445_RS07985 (O4445_07985) | 1696729..1697052 | + | 324 | WP_042462902.1 | hypothetical protein | - |
| O4445_RS07990 (O4445_07990) | 1697049..1697570 | + | 522 | WP_010893241.1 | hypothetical protein | - |
| O4445_RS07995 (O4445_07995) | 1697546..1698088 | + | 543 | WP_023907873.1 | hypothetical protein | - |
| O4445_RS08000 (O4445_08000) | 1698085..1698672 | + | 588 | WP_031336754.1 | phage baseplate assembly protein V | - |
| O4445_RS08005 (O4445_08005) | 1698718..1698999 | - | 282 | WP_060872142.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| O4445_RS08010 (O4445_08010) | 1698986..1699249 | - | 264 | WP_060872141.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| O4445_RS08015 (O4445_08015) | 1699414..1699737 | + | 324 | WP_282454360.1 | GPW/gp25 family protein | - |
| O4445_RS08020 (O4445_08020) | 1699737..1700630 | + | 894 | WP_282454361.1 | baseplate J/gp47 family protein | - |
| O4445_RS08025 (O4445_08025) | 1700623..1701180 | + | 558 | WP_031336758.1 | phage tail protein I | - |
| O4445_RS08030 (O4445_08030) | 1701188..1702780 | + | 1593 | WP_282454362.1 | hypothetical protein | - |
| O4445_RS08035 (O4445_08035) | 1702845..1704023 | + | 1179 | WP_282454363.1 | phage tail sheath family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1668291..1712865 | 44574 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10873.32 Da Isoelectric Point: 7.5805
>T266705 WP_060872142.1 NZ_CP114550:c1698999-1698718 [Xylella fastidiosa subsp. pauca]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVVHALACDHPLEPRHHDHALTGSWKDHRDCHIKPDLVLIYRKPDDETL
QLVRIGSHSELGL
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVVHALACDHPLEPRHHDHALTGSWKDHRDCHIKPDLVLIYRKPDDETL
QLVRIGSHSELGL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L2ALG3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L2ALQ3 |