Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1698718..1699249 Replicon chromosome
Accession NZ_CP114550
Organism Xylella fastidiosa subsp. pauca strain AM2-Angelina

Toxin (Protein)


Gene name relE Uniprot ID A0A1L2ALG3
Locus tag O4445_RS08005 Protein ID WP_060872142.1
Coordinates 1698718..1698999 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A1L2ALQ3
Locus tag O4445_RS08010 Protein ID WP_060872141.1
Coordinates 1698986..1699249 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4445_RS07975 (O4445_07975) 1694571..1696451 + 1881 WP_088372102.1 phage major capsid protein -
O4445_RS07980 (O4445_07980) 1696469..1696729 + 261 WP_060872391.1 hypothetical protein -
O4445_RS07985 (O4445_07985) 1696729..1697052 + 324 WP_042462902.1 hypothetical protein -
O4445_RS07990 (O4445_07990) 1697049..1697570 + 522 WP_010893241.1 hypothetical protein -
O4445_RS07995 (O4445_07995) 1697546..1698088 + 543 WP_023907873.1 hypothetical protein -
O4445_RS08000 (O4445_08000) 1698085..1698672 + 588 WP_031336754.1 phage baseplate assembly protein V -
O4445_RS08005 (O4445_08005) 1698718..1698999 - 282 WP_060872142.1 type II toxin-antitoxin system YafQ family toxin Toxin
O4445_RS08010 (O4445_08010) 1698986..1699249 - 264 WP_060872141.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O4445_RS08015 (O4445_08015) 1699414..1699737 + 324 WP_282454360.1 GPW/gp25 family protein -
O4445_RS08020 (O4445_08020) 1699737..1700630 + 894 WP_282454361.1 baseplate J/gp47 family protein -
O4445_RS08025 (O4445_08025) 1700623..1701180 + 558 WP_031336758.1 phage tail protein I -
O4445_RS08030 (O4445_08030) 1701188..1702780 + 1593 WP_282454362.1 hypothetical protein -
O4445_RS08035 (O4445_08035) 1702845..1704023 + 1179 WP_282454363.1 phage tail sheath family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1668291..1712865 44574


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-84)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10873.32 Da        Isoelectric Point: 7.5805

>T266705 WP_060872142.1 NZ_CP114550:c1698999-1698718 [Xylella fastidiosa subsp. pauca]
MRRISQTGQFKRDYKREAKGQHRATLDEELIHVVHALACDHPLEPRHHDHALTGSWKDHRDCHIKPDLVLIYRKPDDETL
QLVRIGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9437.91 Da        Isoelectric Point: 6.2180

>AT266705 WP_060872141.1 NZ_CP114550:c1699249-1698986 [Xylella fastidiosa subsp. pauca]
MSANAVVRARVDAHIKEEASTVLATMGLSVSDAFRMMLTRIAREKALPFEPLVPNATTIAAMREARAGHLKSFDSIEALM
ADLHAED

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1L2ALG3

Antitoxin

Source ID Structure
AlphaFold DB A0A1L2ALQ3

References