266703

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 1410510..1411072 Replicon chromosome
Accession NZ_CP114550
Organism Xylella fastidiosa subsp. pauca strain AM2-Angelina

Toxin (Protein)


Gene name parE Uniprot ID Q9PBR6
Locus tag O4445_RS06670 Protein ID WP_010894527.1
Coordinates 1410510..1410806 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9PBR5
Locus tag O4445_RS06675 Protein ID WP_010894528.1
Coordinates 1410794..1411072 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4445_RS06615 (O4445_06615) 1405588..1405797 + 210 WP_010894516.1 hypothetical protein -
O4445_RS06620 (O4445_06620) 1405827..1406362 - 536 Protein_1292 recombinase family protein -
O4445_RS06625 (O4445_06625) 1406356..1406595 - 240 WP_069107122.1 hypothetical protein -
O4445_RS06630 (O4445_06630) 1406611..1406880 - 270 WP_010894518.1 hypothetical protein -
O4445_RS06635 (O4445_06635) 1406989..1407297 - 309 WP_010894519.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4445_RS06640 (O4445_06640) 1407301..1407573 - 273 WP_010894520.1 hypothetical protein -
O4445_RS06645 (O4445_06645) 1407570..1408025 - 456 WP_010894521.1 hypothetical protein -
O4445_RS06650 (O4445_06650) 1408434..1408523 - 90 WP_228762876.1 hypothetical protein -
O4445_RS06655 (O4445_06655) 1408605..1408868 - 264 WP_023906433.1 hypothetical protein -
O4445_RS06660 (O4445_06660) 1409433..1409618 - 186 WP_010894523.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4445_RS06665 (O4445_06665) 1409611..1409853 - 243 WP_010894524.1 type II toxin-antitoxin system ParD family antitoxin -
O4445_RS06670 (O4445_06670) 1410510..1410806 - 297 WP_010894527.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4445_RS06675 (O4445_06675) 1410794..1411072 - 279 WP_010894528.1 CopG family ribbon-helix-helix protein Antitoxin
O4445_RS06680 (O4445_06680) 1411855..1412514 + 660 WP_010894530.1 hypothetical protein -
O4445_RS06685 (O4445_06685) 1412534..1412896 + 363 WP_143704175.1 hypothetical protein -
O4445_RS06690 (O4445_06690) 1413007..1413261 + 255 Protein_1306 conjugal transfer protein TrbJ -
O4445_RS06695 (O4445_06695) 1413314..1413595 - 282 WP_010894533.1 type II toxin-antitoxin system YafQ family toxin -
O4445_RS06700 (O4445_06700) 1413582..1413842 - 261 WP_010894534.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
O4445_RS06705 (O4445_06705) 1414172..1414978 - 807 WP_010894535.1 oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-94)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11155.72 Da        Isoelectric Point: 7.4670

>T266703 WP_010894527.1 NZ_CP114550:c1410806-1410510 [Xylella fastidiosa subsp. pauca]
MPRVIFAPEAILNIQRLRNFLHPKNTDAARRAGEAIMRGARMLGAQPHIGRPVDDMPDEYREWLIDFGDSGYVARYHIDG
DTVTILAVRHHKEVGYTS

Download         Length: 297 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10772.08 Da        Isoelectric Point: 5.6126

>AT266703 WP_010894528.1 NZ_CP114550:c1411072-1410794 [Xylella fastidiosa subsp. pauca]
MGMATSIKLDDELKGRVQHLADVRRRTSHWIMREAIAQYVEREEKRETFRQDTLKAWEEFQATGLHVTTEEVEKWLSSWG
TENELSAPVCHG

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1S0VAK4

Antitoxin

Source ID Structure
AlphaFold DB A0A1S0V821

References