Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-DUF971
Location 1220856..1221460 Replicon chromosome
Accession NZ_CP114550
Organism Xylella fastidiosa subsp. pauca strain AM2-Angelina

Toxin (Protein)


Gene name PumA Uniprot ID -
Locus tag O4445_RS05710 Protein ID WP_060872108.1
Coordinates 1221158..1221460 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag O4445_RS05705 Protein ID WP_060872107.1
Coordinates 1220856..1221161 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4445_RS05655 (O4445_05655) 1216722..1216898 + 177 WP_088371569.1 Blp family class II bacteriocin -
O4445_RS05660 (O4445_05660) 1216932..1217120 + 189 WP_088371567.1 hypothetical protein -
O4445_RS05665 (O4445_05665) 1217125..1217295 - 171 WP_088372206.1 antitoxin -
O4445_RS05670 (O4445_05670) 1217348..1217623 - 276 WP_060871810.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4445_RS05675 (O4445_05675) 1217607..1217834 - 228 WP_031336679.1 DUF6290 family protein -
O4445_RS05680 (O4445_05680) 1217943..1218713 + 771 WP_088371565.1 hypothetical protein -
O4445_RS05685 (O4445_05685) 1218713..1219030 + 318 WP_010894089.1 hypothetical protein -
O4445_RS05690 (O4445_05690) 1219027..1219857 + 831 WP_088371563.1 hypothetical protein -
O4445_RS05695 (O4445_05695) 1219854..1220495 + 642 WP_088371561.1 Gp138 family membrane-puncturing spike protein -
O4445_RS05700 (O4445_05700) 1220492..1220845 + 354 WP_088372030.1 hypothetical protein -
O4445_RS05705 (O4445_05705) 1220856..1221161 - 306 WP_060872107.1 putative addiction module antidote protein Antitoxin
O4445_RS05710 (O4445_05710) 1221158..1221460 - 303 WP_060872108.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4445_RS05715 (O4445_05715) 1221559..1222704 + 1146 WP_088371559.1 baseplate J/gp47 family protein -
O4445_RS05720 (O4445_05720) 1222701..1223261 + 561 WP_282454506.1 DUF2612 domain-containing protein -
O4445_RS05725 (O4445_05725) 1223265..1224428 + 1164 WP_282454507.1 phage tail protein -
O4445_RS05730 (O4445_05730) 1224425..1224658 - 234 WP_088371555.1 hypothetical protein -
O4445_RS05735 (O4445_05735) 1224658..1225224 - 567 WP_088371553.1 DUF4065 domain-containing protein -
O4445_RS05740 (O4445_05740) 1225196..1225369 - 174 WP_282454525.1 hypothetical protein -
O4445_RS05745 (O4445_05745) 1225492..1225866 - 375 WP_060870180.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1182321..1230099 47778


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(13-85)

Antitoxin

Uncharacterized protein HI1420

(7-97)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11016.81 Da        Isoelectric Point: 9.6861

>T266702 WP_060872108.1 NZ_CP114550:c1221460-1221158 [Xylella fastidiosa subsp. pauca]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQVRDIEQAKALAALWKDEP

Download         Length: 303 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11052.48 Da        Isoelectric Point: 6.3261

>AT266702 WP_060872107.1 NZ_CP114550:c1221161-1220856 [Xylella fastidiosa subsp. pauca]
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMR

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References