Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
| Location | 1192106..1192902 | Replicon | chromosome |
| Accession | NZ_CP114550 | ||
| Organism | Xylella fastidiosa subsp. pauca strain AM2-Angelina | ||
Toxin (Protein)
| Gene name | VbhT | Uniprot ID | - |
| Locus tag | O4445_RS05470 | Protein ID | WP_023907999.1 |
| Coordinates | 1192291..1192902 (+) | Length | 204 a.a. |
Antitoxin (Protein)
| Gene name | VbhA | Uniprot ID | A0A060HF63 |
| Locus tag | O4445_RS05465 | Protein ID | WP_004087046.1 |
| Coordinates | 1192106..1192294 (+) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4445_RS05430 (O4445_05430) | 1188590..1189516 | - | 927 | WP_088371969.1 | phage recombination protein Bet | - |
| O4445_RS05435 (O4445_05435) | 1189532..1189690 | - | 159 | WP_282454502.1 | hypothetical protein | - |
| O4445_RS05440 (O4445_05440) | 1189711..1189902 | - | 192 | WP_088371617.1 | hypothetical protein | - |
| O4445_RS05445 (O4445_05445) | 1189926..1190117 | - | 192 | WP_010894147.1 | hypothetical protein | - |
| O4445_RS05450 (O4445_05450) | 1190114..1190521 | - | 408 | WP_088371615.1 | hypothetical protein | - |
| O4445_RS05455 (O4445_05455) | 1190521..1190979 | - | 459 | WP_023908001.1 | hypothetical protein | - |
| O4445_RS05460 (O4445_05460) | 1190976..1191704 | - | 729 | WP_023908000.1 | hypothetical protein | - |
| O4445_RS05465 (O4445_05465) | 1192106..1192294 | + | 189 | WP_004087046.1 | antitoxin VbhA family protein | Antitoxin |
| O4445_RS05470 (O4445_05470) | 1192291..1192902 | + | 612 | WP_023907999.1 | Fic/DOC family protein | Toxin |
| O4445_RS05475 (O4445_05475) | 1192953..1193654 | - | 702 | WP_282454503.1 | helix-turn-helix transcriptional regulator | - |
| O4445_RS05480 (O4445_05480) | 1193731..1193976 | + | 246 | WP_088371611.1 | hypothetical protein | - |
| O4445_RS05485 (O4445_05485) | 1194156..1194545 | - | 390 | WP_088371609.1 | hypothetical protein | - |
| O4445_RS05490 (O4445_05490) | 1194673..1194861 | + | 189 | WP_282454504.1 | hypothetical protein | - |
| O4445_RS05495 (O4445_05495) | 1194891..1195106 | + | 216 | WP_282454349.1 | hypothetical protein | - |
| O4445_RS05500 (O4445_05500) | 1195103..1195486 | + | 384 | WP_282454505.1 | hypothetical protein | - |
| O4445_RS05505 (O4445_05505) | 1195690..1196802 | + | 1113 | WP_282454524.1 | Bro-N domain-containing protein | - |
| O4445_RS05510 (O4445_05510) | 1196799..1197089 | + | 291 | Protein_1072 | DUF1376 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1182321..1230099 | 47778 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 204 a.a. Molecular weight: 22919.68 Da Isoelectric Point: 4.9434
>T266699 WP_023907999.1 NZ_CP114550:1192291-1192902 [Xylella fastidiosa subsp. pauca]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE
Download Length: 612 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|