Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 1014984..1015576 | Replicon | chromosome |
| Accession | NZ_CP114550 | ||
| Organism | Xylella fastidiosa subsp. pauca strain AM2-Angelina | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | Q9PD07 |
| Locus tag | O4445_RS04545 | Protein ID | WP_010894094.1 |
| Coordinates | 1015280..1015576 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | O4445_RS04540 | Protein ID | WP_004085592.1 |
| Coordinates | 1014984..1015277 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4445_RS04490 (O4445_04490) | 1010805..1010981 | + | 177 | WP_088371569.1 | Blp family class II bacteriocin | - |
| O4445_RS04495 (O4445_04495) | 1011015..1011203 | + | 189 | WP_088371567.1 | hypothetical protein | - |
| O4445_RS04500 (O4445_04500) | 1011208..1011378 | - | 171 | WP_088372206.1 | antitoxin | - |
| O4445_RS04505 (O4445_04505) | 1011431..1011706 | - | 276 | WP_060871810.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O4445_RS04510 (O4445_04510) | 1011690..1011917 | - | 228 | WP_031336679.1 | DUF6290 family protein | - |
| O4445_RS04515 (O4445_04515) | 1012026..1012796 | + | 771 | WP_088371565.1 | hypothetical protein | - |
| O4445_RS04520 (O4445_04520) | 1012796..1013113 | + | 318 | WP_010894089.1 | hypothetical protein | - |
| O4445_RS04525 (O4445_04525) | 1013110..1013940 | + | 831 | WP_088371563.1 | hypothetical protein | - |
| O4445_RS04530 (O4445_04530) | 1013937..1014578 | + | 642 | WP_088371561.1 | Gp138 family membrane-puncturing spike protein | - |
| O4445_RS04535 (O4445_04535) | 1014575..1014928 | + | 354 | WP_088372030.1 | hypothetical protein | - |
| O4445_RS04540 (O4445_04540) | 1014984..1015277 | - | 294 | WP_004085592.1 | putative addiction module antidote protein | Antitoxin |
| O4445_RS04545 (O4445_04545) | 1015280..1015576 | - | 297 | WP_010894094.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O4445_RS04550 (O4445_04550) | 1015679..1015861 | + | 183 | WP_010894095.1 | baseplate J/gp47 family protein | - |
| O4445_RS04555 (O4445_04555) | 1015843..1016073 | + | 231 | WP_010894096.1 | hypothetical protein | - |
| O4445_RS04560 (O4445_04560) | 1016177..1016623 | - | 447 | WP_031336674.1 | hypothetical protein | - |
| O4445_RS04565 (O4445_04565) | 1016865..1017842 | - | 978 | WP_023906642.1 | hypothetical protein | - |
| O4445_RS04570 (O4445_04570) | 1017839..1018714 | - | 876 | WP_023906641.1 | ABC transporter ATP-binding protein | - |
| O4445_RS04575 (O4445_04575) | 1018933..1019094 | + | 162 | WP_010894100.1 | hypothetical protein | - |
| O4445_RS04580 (O4445_04580) | 1019460..1020032 | + | 573 | WP_282454493.1 | glutathione peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 987140..1015576 | 28436 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11167.73 Da Isoelectric Point: 9.8173
>T266698 WP_010894094.1 NZ_CP114550:c1015576-1015280 [Xylella fastidiosa subsp. pauca]
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQQRGDTIYLLLCGGDKG
LQARDIKTALHLSEQWSE
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQQRGDTIYLLLCGGDKG
LQARDIKTALHLSEQWSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|