Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 1011431..1011917 | Replicon | chromosome |
Accession | NZ_CP114550 | ||
Organism | Xylella fastidiosa subsp. pauca strain AM2-Angelina |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | O4445_RS04505 | Protein ID | WP_060871810.1 |
Coordinates | 1011431..1011706 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | A0A1L2AR28 |
Locus tag | O4445_RS04510 | Protein ID | WP_031336679.1 |
Coordinates | 1011690..1011917 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4445_RS04475 (O4445_04475) | 1007582..1008019 | + | 438 | WP_023907683.1 | DUF3277 family protein | - |
O4445_RS04480 (O4445_04480) | 1008016..1008438 | + | 423 | WP_023907971.1 | putative phage tail assembly chaperone | - |
O4445_RS04485 (O4445_04485) | 1008586..1010475 | + | 1890 | WP_088371571.1 | hypothetical protein | - |
O4445_RS04490 (O4445_04490) | 1010805..1010981 | + | 177 | WP_088371569.1 | Blp family class II bacteriocin | - |
O4445_RS04495 (O4445_04495) | 1011015..1011203 | + | 189 | WP_088371567.1 | hypothetical protein | - |
O4445_RS04500 (O4445_04500) | 1011208..1011378 | - | 171 | WP_088372206.1 | antitoxin | - |
O4445_RS04505 (O4445_04505) | 1011431..1011706 | - | 276 | WP_060871810.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4445_RS04510 (O4445_04510) | 1011690..1011917 | - | 228 | WP_031336679.1 | DUF6290 family protein | Antitoxin |
O4445_RS04515 (O4445_04515) | 1012026..1012796 | + | 771 | WP_088371565.1 | hypothetical protein | - |
O4445_RS04520 (O4445_04520) | 1012796..1013113 | + | 318 | WP_010894089.1 | hypothetical protein | - |
O4445_RS04525 (O4445_04525) | 1013110..1013940 | + | 831 | WP_088371563.1 | hypothetical protein | - |
O4445_RS04530 (O4445_04530) | 1013937..1014578 | + | 642 | WP_088371561.1 | Gp138 family membrane-puncturing spike protein | - |
O4445_RS04535 (O4445_04535) | 1014575..1014928 | + | 354 | WP_088372030.1 | hypothetical protein | - |
O4445_RS04540 (O4445_04540) | 1014984..1015277 | - | 294 | WP_004085592.1 | putative addiction module antidote protein | - |
O4445_RS04545 (O4445_04545) | 1015280..1015576 | - | 297 | WP_010894094.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
O4445_RS04550 (O4445_04550) | 1015679..1015861 | + | 183 | WP_010894095.1 | baseplate J/gp47 family protein | - |
O4445_RS04555 (O4445_04555) | 1015843..1016073 | + | 231 | WP_010894096.1 | hypothetical protein | - |
O4445_RS04560 (O4445_04560) | 1016177..1016623 | - | 447 | WP_031336674.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 987140..1015576 | 28436 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10552.23 Da Isoelectric Point: 10.3419
>T266697 WP_060871810.1 NZ_CP114550:c1011706-1011431 [Xylella fastidiosa subsp. pauca]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|