Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasB-vapB/RelE-VagC
Location 1011208..1011706 Replicon chromosome
Accession NZ_CP114550
Organism Xylella fastidiosa subsp. pauca strain AM2-Angelina

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag O4445_RS04505 Protein ID WP_060871810.1
Coordinates 1011431..1011706 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag O4445_RS04500 Protein ID WP_088372206.1
Coordinates 1011208..1011378 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4445_RS04475 (O4445_04475) 1007582..1008019 + 438 WP_023907683.1 DUF3277 family protein -
O4445_RS04480 (O4445_04480) 1008016..1008438 + 423 WP_023907971.1 putative phage tail assembly chaperone -
O4445_RS04485 (O4445_04485) 1008586..1010475 + 1890 WP_088371571.1 hypothetical protein -
O4445_RS04490 (O4445_04490) 1010805..1010981 + 177 WP_088371569.1 Blp family class II bacteriocin -
O4445_RS04495 (O4445_04495) 1011015..1011203 + 189 WP_088371567.1 hypothetical protein -
O4445_RS04500 (O4445_04500) 1011208..1011378 - 171 WP_088372206.1 antitoxin Antitoxin
O4445_RS04505 (O4445_04505) 1011431..1011706 - 276 WP_060871810.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4445_RS04510 (O4445_04510) 1011690..1011917 - 228 WP_031336679.1 DUF6290 family protein -
O4445_RS04515 (O4445_04515) 1012026..1012796 + 771 WP_088371565.1 hypothetical protein -
O4445_RS04520 (O4445_04520) 1012796..1013113 + 318 WP_010894089.1 hypothetical protein -
O4445_RS04525 (O4445_04525) 1013110..1013940 + 831 WP_088371563.1 hypothetical protein -
O4445_RS04530 (O4445_04530) 1013937..1014578 + 642 WP_088371561.1 Gp138 family membrane-puncturing spike protein -
O4445_RS04535 (O4445_04535) 1014575..1014928 + 354 WP_088372030.1 hypothetical protein -
O4445_RS04540 (O4445_04540) 1014984..1015277 - 294 WP_004085592.1 putative addiction module antidote protein -
O4445_RS04545 (O4445_04545) 1015280..1015576 - 297 WP_010894094.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4445_RS04550 (O4445_04550) 1015679..1015861 + 183 WP_010894095.1 baseplate J/gp47 family protein -
O4445_RS04555 (O4445_04555) 1015843..1016073 + 231 WP_010894096.1 hypothetical protein -
O4445_RS04560 (O4445_04560) 1016177..1016623 - 447 WP_031336674.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 987140..1015576 28436


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

SpoVT-AbrB domain

(16-54)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10552.23 Da        Isoelectric Point: 10.3419

>T266696 WP_060871810.1 NZ_CP114550:c1011706-1011431 [Xylella fastidiosa subsp. pauca]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC

Download         Length: 276 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6537.59 Da        Isoelectric Point: 10.4580

>AT266696 WP_088372206.1 NZ_CP114550:c1011378-1011208 [Xylella fastidiosa subsp. pauca]
MPISSPLSRTKEAKLFRNNRSQVVRIPVEFELPGDRVLIHREEDKLIIEPITRPTN

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References