Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1403318..1403910 | Replicon | chromosome |
Accession | NZ_CP114549 | ||
Organism | Xylella fastidiosa subsp. pauca strain ALM4 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | Q9PD07 |
Locus tag | O4444_RS06505 | Protein ID | WP_010894094.1 |
Coordinates | 1403318..1403614 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | O4444_RS06510 | Protein ID | WP_004085592.1 |
Coordinates | 1403617..1403910 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4444_RS06475 (O4444_06475) | 1398850..1399434 | - | 585 | WP_010894101.1 | glutathione peroxidase | - |
O4444_RS06480 (O4444_06480) | 1399800..1399961 | - | 162 | WP_010894100.1 | hypothetical protein | - |
O4444_RS06485 (O4444_06485) | 1400180..1401055 | + | 876 | WP_023906641.1 | ABC transporter ATP-binding protein | - |
O4444_RS06490 (O4444_06490) | 1401052..1402029 | + | 978 | WP_023906642.1 | hypothetical protein | - |
O4444_RS06495 (O4444_06495) | 1402271..1402717 | + | 447 | WP_282459473.1 | hypothetical protein | - |
O4444_RS06500 (O4444_06500) | 1402917..1403123 | + | 207 | WP_171817075.1 | hypothetical protein | - |
O4444_RS06505 (O4444_06505) | 1403318..1403614 | + | 297 | WP_010894094.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4444_RS06510 (O4444_06510) | 1403617..1403910 | + | 294 | WP_004085592.1 | putative addiction module antidote protein | Antitoxin |
O4444_RS06515 (O4444_06515) | 1403966..1404319 | - | 354 | WP_088372030.1 | hypothetical protein | - |
O4444_RS06520 (O4444_06520) | 1404316..1404957 | - | 642 | WP_282459474.1 | Gp138 family membrane-puncturing spike protein | - |
O4444_RS06525 (O4444_06525) | 1404954..1405784 | - | 831 | WP_282459475.1 | hypothetical protein | - |
O4444_RS06530 (O4444_06530) | 1405781..1406098 | - | 318 | WP_023906646.1 | hypothetical protein | - |
O4444_RS06535 (O4444_06535) | 1406098..1406868 | - | 771 | WP_282459476.1 | hypothetical protein | - |
O4444_RS06540 (O4444_06540) | 1407218..1407472 | - | 255 | WP_282459477.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | pilT | 1366580..1590125 | 223545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11167.73 Da Isoelectric Point: 9.8173
>T266693 WP_010894094.1 NZ_CP114549:1403318-1403614 [Xylella fastidiosa subsp. pauca]
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQQRGDTIYLLLCGGDKG
LQARDIKTALHLSEQWSE
MIELKQTDTFRKWREKLKDARARSAIASRLDRLAFGHVGDAEPVGKGVSELRINYGPGYRVYFQQRGDTIYLLLCGGDKG
LQARDIKTALHLSEQWSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|