Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) FicTA/Fic(toxin)
Location 1225678..1226474 Replicon chromosome
Accession NZ_CP114549
Organism Xylella fastidiosa subsp. pauca strain ALM4

Toxin (Protein)


Gene name VbhT Uniprot ID -
Locus tag O4444_RS05600 Protein ID WP_023907999.1
Coordinates 1225678..1226289 (-) Length 204 a.a.

Antitoxin (Protein)


Gene name VbhA Uniprot ID A0A060HF63
Locus tag O4444_RS05605 Protein ID WP_004087046.1
Coordinates 1226286..1226474 (-) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4444_RS05550 (O4444_05550) 1221133..1221423 - 291 Protein_1080 DUF1376 domain-containing protein -
O4444_RS05555 (O4444_05555) 1221420..1222532 - 1113 WP_282459727.1 Bro-N domain-containing protein -
O4444_RS05560 (O4444_05560) 1222736..1223119 - 384 WP_042463212.1 hypothetical protein -
O4444_RS05565 (O4444_05565) 1223116..1223331 - 216 WP_282459728.1 hypothetical protein -
O4444_RS05570 (O4444_05570) 1223361..1223549 - 189 WP_023907993.1 hypothetical protein -
O4444_RS05575 (O4444_05575) 1223610..1223951 - 342 WP_282459729.1 hypothetical protein -
O4444_RS05580 (O4444_05580) 1223848..1224060 + 213 Protein_1086 hypothetical protein -
O4444_RS05585 (O4444_05585) 1224053..1224424 + 372 WP_282459730.1 hypothetical protein -
O4444_RS05590 (O4444_05590) 1224604..1224849 - 246 WP_282459731.1 hypothetical protein -
O4444_RS05595 (O4444_05595) 1224866..1225627 + 762 WP_282459732.1 helix-turn-helix transcriptional regulator -
O4444_RS05600 (O4444_05600) 1225678..1226289 - 612 WP_023907999.1 Fic/DOC family protein Toxin
O4444_RS05605 (O4444_05605) 1226286..1226474 - 189 WP_004087046.1 antitoxin VbhA family protein Antitoxin
O4444_RS05610 (O4444_05610) 1226876..1227604 + 729 WP_023908000.1 hypothetical protein -
O4444_RS05615 (O4444_05615) 1227601..1228059 + 459 WP_023908001.1 hypothetical protein -
O4444_RS05620 (O4444_05620) 1228059..1228466 + 408 WP_088371615.1 hypothetical protein -
O4444_RS05625 (O4444_05625) 1228463..1228654 + 192 WP_010894147.1 hypothetical protein -
O4444_RS05630 (O4444_05630) 1228678..1228869 + 192 WP_088371617.1 hypothetical protein -
O4444_RS05635 (O4444_05635) 1228890..1229048 + 159 WP_282454502.1 hypothetical protein -
O4444_RS05640 (O4444_05640) 1229064..1229990 + 927 WP_023908009.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1193057..1236259 43202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(55-152)

Antitoxin

Antitoxin VbhA

(10-56)


Sequences

Toxin        


Download         Length: 204 a.a.        Molecular weight: 22919.68 Da        Isoelectric Point: 4.9434

>T266692 WP_023907999.1 NZ_CP114549:c1226289-1225678 [Xylella fastidiosa subsp. pauca]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE

Download         Length: 612 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6855.80 Da        Isoelectric Point: 4.9859

>AT266692 WP_004087046.1 NZ_CP114549:c1226474-1226286 [Xylella fastidiosa subsp. pauca]
MLTDHEKAERRAVVQSALASQRIEGLEPDAQAVVDAECWARGEMTIAAAVDQYKARVRLQMA

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A060HF63

References