Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
Location | 1225678..1226474 | Replicon | chromosome |
Accession | NZ_CP114549 | ||
Organism | Xylella fastidiosa subsp. pauca strain ALM4 |
Toxin (Protein)
Gene name | VbhT | Uniprot ID | - |
Locus tag | O4444_RS05600 | Protein ID | WP_023907999.1 |
Coordinates | 1225678..1226289 (-) | Length | 204 a.a. |
Antitoxin (Protein)
Gene name | VbhA | Uniprot ID | A0A060HF63 |
Locus tag | O4444_RS05605 | Protein ID | WP_004087046.1 |
Coordinates | 1226286..1226474 (-) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4444_RS05550 (O4444_05550) | 1221133..1221423 | - | 291 | Protein_1080 | DUF1376 domain-containing protein | - |
O4444_RS05555 (O4444_05555) | 1221420..1222532 | - | 1113 | WP_282459727.1 | Bro-N domain-containing protein | - |
O4444_RS05560 (O4444_05560) | 1222736..1223119 | - | 384 | WP_042463212.1 | hypothetical protein | - |
O4444_RS05565 (O4444_05565) | 1223116..1223331 | - | 216 | WP_282459728.1 | hypothetical protein | - |
O4444_RS05570 (O4444_05570) | 1223361..1223549 | - | 189 | WP_023907993.1 | hypothetical protein | - |
O4444_RS05575 (O4444_05575) | 1223610..1223951 | - | 342 | WP_282459729.1 | hypothetical protein | - |
O4444_RS05580 (O4444_05580) | 1223848..1224060 | + | 213 | Protein_1086 | hypothetical protein | - |
O4444_RS05585 (O4444_05585) | 1224053..1224424 | + | 372 | WP_282459730.1 | hypothetical protein | - |
O4444_RS05590 (O4444_05590) | 1224604..1224849 | - | 246 | WP_282459731.1 | hypothetical protein | - |
O4444_RS05595 (O4444_05595) | 1224866..1225627 | + | 762 | WP_282459732.1 | helix-turn-helix transcriptional regulator | - |
O4444_RS05600 (O4444_05600) | 1225678..1226289 | - | 612 | WP_023907999.1 | Fic/DOC family protein | Toxin |
O4444_RS05605 (O4444_05605) | 1226286..1226474 | - | 189 | WP_004087046.1 | antitoxin VbhA family protein | Antitoxin |
O4444_RS05610 (O4444_05610) | 1226876..1227604 | + | 729 | WP_023908000.1 | hypothetical protein | - |
O4444_RS05615 (O4444_05615) | 1227601..1228059 | + | 459 | WP_023908001.1 | hypothetical protein | - |
O4444_RS05620 (O4444_05620) | 1228059..1228466 | + | 408 | WP_088371615.1 | hypothetical protein | - |
O4444_RS05625 (O4444_05625) | 1228463..1228654 | + | 192 | WP_010894147.1 | hypothetical protein | - |
O4444_RS05630 (O4444_05630) | 1228678..1228869 | + | 192 | WP_088371617.1 | hypothetical protein | - |
O4444_RS05635 (O4444_05635) | 1228890..1229048 | + | 159 | WP_282454502.1 | hypothetical protein | - |
O4444_RS05640 (O4444_05640) | 1229064..1229990 | + | 927 | WP_023908009.1 | phage recombination protein Bet | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1193057..1236259 | 43202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 204 a.a. Molecular weight: 22919.68 Da Isoelectric Point: 4.9434
>T266692 WP_023907999.1 NZ_CP114549:c1226289-1225678 [Xylella fastidiosa subsp. pauca]
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE
MKYAGDRGDPYLDSETGVLRNLLGIRDQGWLDKIESTLSFLRTSELRERPVKGKFDLAHLQEIHNRLFQDVYDWAGQIRQ
VEISKGNTMFAQQIAIQSAAQQIFGQLAKEQFLCGLDAEEFSKRAGDYLGEINVLHPFREGNGRTQREFIAQLAQRAGYR
IDWGVVSQADMIKASIDAYNGDSSGLASIIRDGISDQLFKDNE
Download Length: 612 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|