266690

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 1200450..1200936 Replicon chromosome
Accession NZ_CP114549
Organism Xylella fastidiosa subsp. pauca strain ALM4

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag O4444_RS05380 Protein ID WP_060871810.1
Coordinates 1200661..1200936 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A1L2AR28
Locus tag O4444_RS05375 Protein ID WP_031336679.1
Coordinates 1200450..1200677 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4444_RS05335 (O4444_05335) 1195577..1196722 - 1146 WP_282459717.1 baseplate J/gp47 family protein -
O4444_RS05340 (O4444_05340) 1196821..1197123 + 303 WP_042463224.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4444_RS05345 (O4444_05345) 1197120..1197425 + 306 WP_004089254.1 putative addiction module antidote protein -
O4444_RS05350 (O4444_05350) 1197436..1197789 - 354 WP_282459718.1 hypothetical protein -
O4444_RS05355 (O4444_05355) 1197786..1198427 - 642 WP_282459719.1 Gp138 family membrane-puncturing spike protein -
O4444_RS05360 (O4444_05360) 1198424..1199254 - 831 WP_282459720.1 hypothetical protein -
O4444_RS05365 (O4444_05365) 1199251..1199571 - 321 WP_282459721.1 hypothetical protein -
O4444_RS05370 (O4444_05370) 1199571..1200341 - 771 WP_282459722.1 hypothetical protein -
O4444_RS05375 (O4444_05375) 1200450..1200677 + 228 WP_031336679.1 DUF6290 family protein Antitoxin
O4444_RS05380 (O4444_05380) 1200661..1200936 + 276 WP_060871810.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4444_RS05385 (O4444_05385) 1200989..1201159 + 171 WP_088372206.1 antitoxin -
O4444_RS05390 (O4444_05390) 1201164..1201352 - 189 WP_088371567.1 hypothetical protein -
O4444_RS05395 (O4444_05395) 1201386..1201562 - 177 WP_088371569.1 Blp family class II bacteriocin -
O4444_RS05400 (O4444_05400) 1201892..1203781 - 1890 WP_282459478.1 hypothetical protein -
O4444_RS05405 (O4444_05405) 1203929..1204351 - 423 WP_282459479.1 putative phage tail assembly chaperone -
O4444_RS05410 (O4444_05410) 1204348..1204785 - 438 WP_060870494.1 DUF3277 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1193057..1236259 43202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10552.23 Da        Isoelectric Point: 10.3419

>T266690 WP_060871810.1 NZ_CP114549:1200661-1200936 [Xylella fastidiosa subsp. pauca]
MAWTIDYTDTAKQQLRKLDKHMARRIVDFMDERIAGLENPRSSGKALTGPLGGFWRYRVGDFRVVCAIQDSVLRVLVVRV
GHRGEIYRREC

Download         Length: 276 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8691.73 Da        Isoelectric Point: 5.0958

>AT266690 WP_031336679.1 NZ_CP114549:1200450-1200677 [Xylella fastidiosa subsp. pauca]
MATSIRLSPEMEQRLNYLASHTGRTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1L2AR28

References