Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-DUF971
Location 1196821..1197425 Replicon chromosome
Accession NZ_CP114549
Organism Xylella fastidiosa subsp. pauca strain ALM4

Toxin (Protein)


Gene name PumA Uniprot ID -
Locus tag O4444_RS05340 Protein ID WP_042463224.1
Coordinates 1196821..1197123 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag O4444_RS05345 Protein ID WP_004089254.1
Coordinates 1197120..1197425 (+) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4444_RS05305 (O4444_05305) 1192415..1192789 + 375 WP_060870180.1 hypothetical protein -
O4444_RS05310 (O4444_05310) 1192870..1193085 + 216 WP_228762693.1 helix-turn-helix domain-containing protein -
O4444_RS05315 (O4444_05315) 1193057..1193623 + 567 WP_088371553.1 DUF4065 domain-containing protein -
O4444_RS05320 (O4444_05320) 1193626..1193856 + 231 WP_282459714.1 hypothetical protein -
O4444_RS05325 (O4444_05325) 1193853..1195016 - 1164 WP_282459715.1 phage tail protein -
O4444_RS05330 (O4444_05330) 1195020..1195580 - 561 WP_282459716.1 DUF2612 domain-containing protein -
O4444_RS05335 (O4444_05335) 1195577..1196722 - 1146 WP_282459717.1 baseplate J/gp47 family protein -
O4444_RS05340 (O4444_05340) 1196821..1197123 + 303 WP_042463224.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4444_RS05345 (O4444_05345) 1197120..1197425 + 306 WP_004089254.1 putative addiction module antidote protein Antitoxin
O4444_RS05350 (O4444_05350) 1197436..1197789 - 354 WP_282459718.1 hypothetical protein -
O4444_RS05355 (O4444_05355) 1197786..1198427 - 642 WP_282459719.1 Gp138 family membrane-puncturing spike protein -
O4444_RS05360 (O4444_05360) 1198424..1199254 - 831 WP_282459720.1 hypothetical protein -
O4444_RS05365 (O4444_05365) 1199251..1199571 - 321 WP_282459721.1 hypothetical protein -
O4444_RS05370 (O4444_05370) 1199571..1200341 - 771 WP_282459722.1 hypothetical protein -
O4444_RS05375 (O4444_05375) 1200450..1200677 + 228 WP_031336679.1 DUF6290 family protein -
O4444_RS05380 (O4444_05380) 1200661..1200936 + 276 WP_060871810.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4444_RS05385 (O4444_05385) 1200989..1201159 + 171 WP_088372206.1 antitoxin -
O4444_RS05390 (O4444_05390) 1201164..1201352 - 189 WP_088371567.1 hypothetical protein -
O4444_RS05395 (O4444_05395) 1201386..1201562 - 177 WP_088371569.1 Blp family class II bacteriocin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1193057..1236259 43202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-94)

Antitoxin

Cro/C1-type helix-turn-helix domain

(49-95)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11048.87 Da        Isoelectric Point: 9.6861

>T266689 WP_042463224.1 NZ_CP114549:1196821-1197123 [Xylella fastidiosa subsp. pauca]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQMRDIEQAKALAALWKDEP

Download         Length: 303 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 10983.37 Da        Isoelectric Point: 5.0941

>AT266689 WP_004089254.1 NZ_CP114549:1197120-1197425 [Xylella fastidiosa subsp. pauca]
MNNETFSRYDTADYLKTEEDIAAYMEAVMEEGGRDNPAFIARALGAVARARNLSQLARDVGMSRQGLDKALSNDGNPSFS
TILKVAKALGLRMSFTPSSMS

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References