Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/COG3657-DUF971 |
| Location | 1196821..1197425 | Replicon | chromosome |
| Accession | NZ_CP114549 | ||
| Organism | Xylella fastidiosa subsp. pauca strain ALM4 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | O4444_RS05340 | Protein ID | WP_042463224.1 |
| Coordinates | 1196821..1197123 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | O4444_RS05345 | Protein ID | WP_004089254.1 |
| Coordinates | 1197120..1197425 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4444_RS05305 (O4444_05305) | 1192415..1192789 | + | 375 | WP_060870180.1 | hypothetical protein | - |
| O4444_RS05310 (O4444_05310) | 1192870..1193085 | + | 216 | WP_228762693.1 | helix-turn-helix domain-containing protein | - |
| O4444_RS05315 (O4444_05315) | 1193057..1193623 | + | 567 | WP_088371553.1 | DUF4065 domain-containing protein | - |
| O4444_RS05320 (O4444_05320) | 1193626..1193856 | + | 231 | WP_282459714.1 | hypothetical protein | - |
| O4444_RS05325 (O4444_05325) | 1193853..1195016 | - | 1164 | WP_282459715.1 | phage tail protein | - |
| O4444_RS05330 (O4444_05330) | 1195020..1195580 | - | 561 | WP_282459716.1 | DUF2612 domain-containing protein | - |
| O4444_RS05335 (O4444_05335) | 1195577..1196722 | - | 1146 | WP_282459717.1 | baseplate J/gp47 family protein | - |
| O4444_RS05340 (O4444_05340) | 1196821..1197123 | + | 303 | WP_042463224.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O4444_RS05345 (O4444_05345) | 1197120..1197425 | + | 306 | WP_004089254.1 | putative addiction module antidote protein | Antitoxin |
| O4444_RS05350 (O4444_05350) | 1197436..1197789 | - | 354 | WP_282459718.1 | hypothetical protein | - |
| O4444_RS05355 (O4444_05355) | 1197786..1198427 | - | 642 | WP_282459719.1 | Gp138 family membrane-puncturing spike protein | - |
| O4444_RS05360 (O4444_05360) | 1198424..1199254 | - | 831 | WP_282459720.1 | hypothetical protein | - |
| O4444_RS05365 (O4444_05365) | 1199251..1199571 | - | 321 | WP_282459721.1 | hypothetical protein | - |
| O4444_RS05370 (O4444_05370) | 1199571..1200341 | - | 771 | WP_282459722.1 | hypothetical protein | - |
| O4444_RS05375 (O4444_05375) | 1200450..1200677 | + | 228 | WP_031336679.1 | DUF6290 family protein | - |
| O4444_RS05380 (O4444_05380) | 1200661..1200936 | + | 276 | WP_060871810.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O4444_RS05385 (O4444_05385) | 1200989..1201159 | + | 171 | WP_088372206.1 | antitoxin | - |
| O4444_RS05390 (O4444_05390) | 1201164..1201352 | - | 189 | WP_088371567.1 | hypothetical protein | - |
| O4444_RS05395 (O4444_05395) | 1201386..1201562 | - | 177 | WP_088371569.1 | Blp family class II bacteriocin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1193057..1236259 | 43202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11048.87 Da Isoelectric Point: 9.6861
>T266689 WP_042463224.1 NZ_CP114549:1196821-1197123 [Xylella fastidiosa subsp. pauca]
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQMRDIEQAKALAALWKDEP
MVELIKTSTFDAWINSLRDRKAAARIQARLDRLALGNPGDVKPVGAGISEMRIDHGPGYRIYFMKHGAVLILLLCGGDKS
SQMRDIEQAKALAALWKDEP
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|