Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 997353..997915 | Replicon | chromosome |
| Accession | NZ_CP114549 | ||
| Organism | Xylella fastidiosa subsp. pauca strain ALM4 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q9PBR6 |
| Locus tag | O4444_RS04295 | Protein ID | WP_010894527.1 |
| Coordinates | 997619..997915 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9PBR5 |
| Locus tag | O4444_RS04290 | Protein ID | WP_010894528.1 |
| Coordinates | 997353..997631 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4444_RS04260 (O4444_04260) | 993447..994253 | + | 807 | WP_010894535.1 | oxidoreductase | - |
| O4444_RS04265 (O4444_04265) | 994583..994843 | + | 261 | WP_010894534.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| O4444_RS04270 (O4444_04270) | 994830..995111 | + | 282 | WP_010894533.1 | type II toxin-antitoxin system YafQ family toxin | - |
| O4444_RS04275 (O4444_04275) | 995164..995418 | - | 255 | Protein_827 | conjugal transfer protein TrbJ | - |
| O4444_RS04280 (O4444_04280) | 995529..995891 | - | 363 | WP_143704175.1 | hypothetical protein | - |
| O4444_RS04285 (O4444_04285) | 995911..996570 | - | 660 | WP_010894530.1 | hypothetical protein | - |
| O4444_RS04290 (O4444_04290) | 997353..997631 | + | 279 | WP_010894528.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| O4444_RS04295 (O4444_04295) | 997619..997915 | + | 297 | WP_010894527.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O4444_RS04300 (O4444_04300) | 998572..998814 | + | 243 | WP_010894524.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| O4444_RS04305 (O4444_04305) | 998807..998992 | + | 186 | WP_010894523.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O4444_RS04310 (O4444_04310) | 999250..999507 | + | 258 | WP_140190226.1 | hypothetical protein | - |
| O4444_RS04315 (O4444_04315) | 999557..999820 | + | 264 | WP_023906433.1 | hypothetical protein | - |
| O4444_RS04320 (O4444_04320) | 999902..999991 | + | 90 | WP_228762876.1 | hypothetical protein | - |
| O4444_RS04325 (O4444_04325) | 1000400..1000855 | + | 456 | WP_010894521.1 | hypothetical protein | - |
| O4444_RS04330 (O4444_04330) | 1000852..1001124 | + | 273 | WP_010894520.1 | hypothetical protein | - |
| O4444_RS04335 (O4444_04335) | 1001128..1001436 | + | 309 | WP_010894519.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O4444_RS04340 (O4444_04340) | 1001545..1001814 | + | 270 | WP_010894518.1 | hypothetical protein | - |
| O4444_RS04345 (O4444_04345) | 1001866..1002069 | + | 204 | WP_023906434.1 | hypothetical protein | - |
| O4444_RS04350 (O4444_04350) | 1002063..1002598 | + | 536 | Protein_842 | recombinase family protein | - |
| O4444_RS04355 (O4444_04355) | 1002628..1002837 | - | 210 | WP_010894516.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11155.72 Da Isoelectric Point: 7.4670
>T266688 WP_010894527.1 NZ_CP114549:997619-997915 [Xylella fastidiosa subsp. pauca]
MPRVIFAPEAILNIQRLRNFLHPKNTDAARRAGEAIMRGARMLGAQPHIGRPVDDMPDEYREWLIDFGDSGYVARYHIDG
DTVTILAVRHHKEVGYTS
MPRVIFAPEAILNIQRLRNFLHPKNTDAARRAGEAIMRGARMLGAQPHIGRPVDDMPDEYREWLIDFGDSGYVARYHIDG
DTVTILAVRHHKEVGYTS
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S0VAK4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S0V821 |