266688

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 997353..997915 Replicon chromosome
Accession NZ_CP114549
Organism Xylella fastidiosa subsp. pauca strain ALM4

Toxin (Protein)


Gene name parE Uniprot ID Q9PBR6
Locus tag O4444_RS04295 Protein ID WP_010894527.1
Coordinates 997619..997915 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9PBR5
Locus tag O4444_RS04290 Protein ID WP_010894528.1
Coordinates 997353..997631 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O4444_RS04260 (O4444_04260) 993447..994253 + 807 WP_010894535.1 oxidoreductase -
O4444_RS04265 (O4444_04265) 994583..994843 + 261 WP_010894534.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
O4444_RS04270 (O4444_04270) 994830..995111 + 282 WP_010894533.1 type II toxin-antitoxin system YafQ family toxin -
O4444_RS04275 (O4444_04275) 995164..995418 - 255 Protein_827 conjugal transfer protein TrbJ -
O4444_RS04280 (O4444_04280) 995529..995891 - 363 WP_143704175.1 hypothetical protein -
O4444_RS04285 (O4444_04285) 995911..996570 - 660 WP_010894530.1 hypothetical protein -
O4444_RS04290 (O4444_04290) 997353..997631 + 279 WP_010894528.1 CopG family ribbon-helix-helix protein Antitoxin
O4444_RS04295 (O4444_04295) 997619..997915 + 297 WP_010894527.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O4444_RS04300 (O4444_04300) 998572..998814 + 243 WP_010894524.1 type II toxin-antitoxin system ParD family antitoxin -
O4444_RS04305 (O4444_04305) 998807..998992 + 186 WP_010894523.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4444_RS04310 (O4444_04310) 999250..999507 + 258 WP_140190226.1 hypothetical protein -
O4444_RS04315 (O4444_04315) 999557..999820 + 264 WP_023906433.1 hypothetical protein -
O4444_RS04320 (O4444_04320) 999902..999991 + 90 WP_228762876.1 hypothetical protein -
O4444_RS04325 (O4444_04325) 1000400..1000855 + 456 WP_010894521.1 hypothetical protein -
O4444_RS04330 (O4444_04330) 1000852..1001124 + 273 WP_010894520.1 hypothetical protein -
O4444_RS04335 (O4444_04335) 1001128..1001436 + 309 WP_010894519.1 type II toxin-antitoxin system RelE/ParE family toxin -
O4444_RS04340 (O4444_04340) 1001545..1001814 + 270 WP_010894518.1 hypothetical protein -
O4444_RS04345 (O4444_04345) 1001866..1002069 + 204 WP_023906434.1 hypothetical protein -
O4444_RS04350 (O4444_04350) 1002063..1002598 + 536 Protein_842 recombinase family protein -
O4444_RS04355 (O4444_04355) 1002628..1002837 - 210 WP_010894516.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-94)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11155.72 Da        Isoelectric Point: 7.4670

>T266688 WP_010894527.1 NZ_CP114549:997619-997915 [Xylella fastidiosa subsp. pauca]
MPRVIFAPEAILNIQRLRNFLHPKNTDAARRAGEAIMRGARMLGAQPHIGRPVDDMPDEYREWLIDFGDSGYVARYHIDG
DTVTILAVRHHKEVGYTS

Download         Length: 297 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10772.08 Da        Isoelectric Point: 5.6126

>AT266688 WP_010894528.1 NZ_CP114549:997353-997631 [Xylella fastidiosa subsp. pauca]
MGMATSIKLDDELKGRVQHLADVRRRTSHWIMREAIAQYVEREEKRETFRQDTLKAWEEFQATGLHVTTEEVEKWLSSWG
TENELSAPVCHG

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1S0VAK4

Antitoxin

Source ID Structure
AlphaFold DB A0A1S0V821

References