Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-RHH |
Location | 2966210..2966784 | Replicon | chromosome |
Accession | NZ_CP114542 | ||
Organism | Brevundimonas subvibrioides strain Br6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O3139_RS14675 | Protein ID | WP_269514836.1 |
Coordinates | 2966210..2966575 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O3139_RS14680 | Protein ID | WP_269514837.1 |
Coordinates | 2966569..2966784 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3139_RS14655 | 2961990..2962397 | - | 408 | WP_269514833.1 | GxxExxY protein | - |
O3139_RS14660 | 2962434..2963609 | - | 1176 | WP_269516501.1 | aspartate aminotransferase family protein | - |
O3139_RS14665 | 2963859..2964680 | - | 822 | WP_269514834.1 | ABC transporter permease | - |
O3139_RS14670 | 2964800..2966197 | - | 1398 | WP_269514835.1 | dihydrolipoyl dehydrogenase | - |
O3139_RS14675 | 2966210..2966575 | - | 366 | WP_269514836.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O3139_RS14680 | 2966569..2966784 | - | 216 | WP_269514837.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
O3139_RS14685 | 2966845..2968623 | - | 1779 | WP_269514838.1 | 2-oxo acid dehydrogenase subunit E2 | - |
O3139_RS14690 | 2968623..2969744 | - | 1122 | WP_269514839.1 | alpha-ketoacid dehydrogenase subunit beta | - |
O3139_RS14695 | 2969741..2970973 | - | 1233 | WP_269514840.1 | 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) subunit alpha | - |
O3139_RS14700 | 2971118..2971609 | + | 492 | WP_209321921.1 | Lrp/AsnC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13386.18 Da Isoelectric Point: 4.3367
>T266684 WP_269514836.1 NZ_CP114542:c2966575-2966210 [Brevundimonas subvibrioides]
MVKALFDTNILIDHLNAAPEADAEIDRYDDRAISIITWIEVMAGADAELADPTRTYLDGYSIVALDDPIAERAASIRQSR
RMKLPDAIIWATAQTTGRLLVTRNTKDFPADDPGVRAPYVL
MVKALFDTNILIDHLNAAPEADAEIDRYDDRAISIITWIEVMAGADAELADPTRTYLDGYSIVALDDPIAERAASIRQSR
RMKLPDAIIWATAQTTGRLLVTRNTKDFPADDPGVRAPYVL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|