Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2880629..2881253 | Replicon | chromosome |
Accession | NZ_CP114542 | ||
Organism | Brevundimonas subvibrioides strain Br6 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O3139_RS14255 | Protein ID | WP_269514762.1 |
Coordinates | 2880927..2881253 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | O3139_RS14250 | Protein ID | WP_269514761.1 |
Coordinates | 2880629..2880937 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3139_RS14230 | 2877100..2877519 | - | 420 | WP_269514758.1 | large-conductance mechanosensitive channel protein MscL | - |
O3139_RS14235 | 2877537..2877827 | - | 291 | WP_209322409.1 | integration host factor subunit beta | - |
O3139_RS14240 | 2878121..2879824 | - | 1704 | WP_269514759.1 | 30S ribosomal protein S1 | - |
O3139_RS14245 | 2879982..2880632 | - | 651 | WP_269514760.1 | (d)CMP kinase | - |
O3139_RS14250 | 2880629..2880937 | - | 309 | WP_269514761.1 | putative addiction module antidote protein | Antitoxin |
O3139_RS14255 | 2880927..2881253 | - | 327 | WP_269514762.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O3139_RS14260 | 2881258..2882556 | - | 1299 | WP_269516498.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
O3139_RS14265 | 2882712..2883176 | + | 465 | WP_209322405.1 | TIGR02300 family protein | - |
O3139_RS14275 | 2883481..2885175 | - | 1695 | WP_269514763.1 | MFS transporter | - |
O3139_RS14280 | 2885346..2885759 | + | 414 | WP_269514764.1 | Hsp20 family protein | - |
O3139_RS14285 | 2885850..2886104 | + | 255 | WP_269516499.1 | DUF1150 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12155.59 Da Isoelectric Point: 7.2042
>T266683 WP_269514762.1 NZ_CP114542:c2881253-2880927 [Brevundimonas subvibrioides]
MSPIDDSSGFELEFSETFDAWLQGLRDHRAAARITVRLERLERGHWGDARSVGEGVTELRIDYGPGYRLYAARRGRRIVL
MLAGGDKSSQRRDIEAAKVLAREYGDGT
MSPIDDSSGFELEFSETFDAWLQGLRDHRAAARITVRLERLERGHWGDARSVGEGVTELRIDYGPGYRLYAARRGRRIVL
MLAGGDKSSQRRDIEAAKVLAREYGDGT
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|