Detailed information of TA system TA266682

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): BrnTA/BrnT-BrnA
• Location: 2753449..2753983
• Replicon: chromosome
• Accession: NZ_CP114542
• Organism: Brevundimonas subvibrioides strain Br6

Toxin (Protein)

• Gene name: brnT
• Uniprot ID: -
• Locus tag: O3139_RS13660
• Protein ID: WP_269514642.1
• Coordinates: 2753684..2753983 (-)
• Length: 100 a.a.

Antitoxin (Protein)

• Gene name: brnA
• Uniprot ID: -
• Locus tag: O3139_RS13655
• Protein ID: WP_269514641.1
• Coordinates: 2753449..2753664 (-)
• Length: 72 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
O3139_RS13615	2748616..2749170	-	555	WP_269514627.1	alpha/beta hydrolase	-
O3139_RS13620	2749178..2749486	-	309	WP_269514629.1	hypothetical protein	-
O3139_RS13625	2749483..2750898	-	1416	WP_269514630.1	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	-
O3139_RS13630	2750909..2751214	-	306	WP_269514632.1	hypothetical protein	-
O3139_RS13635	2751211..2751555	-	345	WP_269514634.1	NAD(P) transhydrogenase subunit alpha	-
O3139_RS13640	2751555..2751809	-	255	WP_269514636.1	hypothetical protein	-
O3139_RS13645	2751806..2752939	-	1134	WP_269514638.1	Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha	-
O3139_RS13650	2753105..2753380	-	276	WP_269514640.1	aa3-type cytochrome c oxidase subunit IV	-
O3139_RS13655	2753449..2753664	-	216	WP_269514641.1	BrnA antitoxin family protein	Antitoxin
O3139_RS13660	2753684..2753983	-	300	WP_269514642.1	BrnT family toxin	Toxin
O3139_RS13665	2754022..2755830	-	1809	WP_269514644.1	M3 family oligoendopeptidase	-
O3139_RS13670	2755936..2756421	+	486	WP_269514646.1	DUF1203 domain-containing protein	-
O3139_RS13675	2756471..2758261	+	1791	WP_269514648.1	DUF4153 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (5-86)

Antitoxin

• BrnA antitoxin of type II toxin-antitoxin system (11-64)

Sequences

Toxin

Protein

• Length: 100 a.a.
• Molecular weight: 11498.98 Da
• Isoelectric Point: 6.7298

>T266682 WP_269514642.1 NZ_CP114542:c2753983-2753684 [Brevundimonas subvibrioides]
MKFDWDPEKAKANFAKHGVAFDVAMRVFDDPRSVTVFDRTVAGEERWRTVGRVGVATILFVAHTWLDEDGELYVRIISAR
RADRLEIRAYERGDEGHFR

Nucleotide

• Length: 300 bp

Antitoxin

Protein

• Length: 72 a.a.
• Molecular weight: 8241.40 Da
• Isoelectric Point: 8.4539

>AT266682 WP_269514641.1 NZ_CP114542:c2753664-2753449 [Brevundimonas subvibrioides]
MRDEDIDYSDIPPVRDWSGAKRGLFYRPEKQAVTIRLDADVVAWFKSVEPKYQTAVNRVLREYMLAHAKAG

Nucleotide

• Length: 216 bp