Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2279701..2280341 | Replicon | chromosome |
Accession | NZ_CP114542 | ||
Organism | Brevundimonas subvibrioides strain Br6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O3139_RS11440 | Protein ID | WP_269514198.1 |
Coordinates | 2279701..2280090 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O3139_RS11445 | Protein ID | WP_269514199.1 |
Coordinates | 2280087..2280341 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3139_RS11425 | 2275266..2276228 | - | 963 | WP_269514195.1 | M20/M25/M40 family metallo-hydrolase | - |
O3139_RS11430 | 2276341..2278656 | + | 2316 | WP_269514196.1 | NAD-dependent DNA ligase LigA | - |
O3139_RS11435 | 2278653..2279642 | - | 990 | WP_269514197.1 | aldo/keto reductase | - |
O3139_RS11440 | 2279701..2280090 | - | 390 | WP_269514198.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O3139_RS11445 | 2280087..2280341 | - | 255 | WP_269514199.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
O3139_RS11450 | 2280376..2282187 | - | 1812 | WP_269514200.1 | aminopeptidase P family protein | - |
O3139_RS11455 | 2282205..2283074 | - | 870 | WP_269514201.1 | 50S ribosomal protein L11 methyltransferase | - |
O3139_RS11460 | 2283176..2283766 | + | 591 | WP_269514202.1 | hypothetical protein | - |
O3139_RS11465 | 2283840..2284052 | - | 213 | WP_269514203.1 | DUF3126 family protein | - |
O3139_RS11470 | 2284124..2284945 | - | 822 | WP_269514204.1 | serine O-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14701.80 Da Isoelectric Point: 5.2866
>T266681 WP_269514198.1 NZ_CP114542:c2280090-2279701 [Brevundimonas subvibrioides]
MIVDSSALVAILFNEPEAAEFARLMMREPCRISAANYFEAGMVVDRKTRDEIPRQAFDTLVATTRLDIVDVTREQADEAR
MAYRRFGKGYHEARLNFGDCFAYVLARRTGEPLLFKGDDFARTDVVRAL
MIVDSSALVAILFNEPEAAEFARLMMREPCRISAANYFEAGMVVDRKTRDEIPRQAFDTLVATTRLDIVDVTREQADEAR
MAYRRFGKGYHEARLNFGDCFAYVLARRTGEPLLFKGDDFARTDVVRAL
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|