Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 993054..993703 | Replicon | chromosome |
Accession | NZ_CP114542 | ||
Organism | Brevundimonas subvibrioides strain Br6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O3139_RS04960 | Protein ID | WP_269515869.1 |
Coordinates | 993299..993703 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O3139_RS04955 | Protein ID | WP_269515868.1 |
Coordinates | 993054..993302 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3139_RS04935 | 988501..989457 | + | 957 | WP_269515864.1 | hypothetical protein | - |
O3139_RS04940 | 989465..989731 | - | 267 | WP_269515865.1 | hypothetical protein | - |
O3139_RS04945 | 989920..991068 | - | 1149 | WP_269515866.1 | patatin-like phospholipase family protein | - |
O3139_RS04950 | 991161..993029 | + | 1869 | WP_269515867.1 | DNA primase | - |
O3139_RS04955 | 993054..993302 | + | 249 | WP_269515868.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
O3139_RS04960 | 993299..993703 | + | 405 | WP_269515869.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O3139_RS04965 | 993700..994038 | + | 339 | WP_269515870.1 | hypothetical protein | - |
O3139_RS04970 | 994131..996095 | + | 1965 | WP_269515871.1 | RNA polymerase sigma factor RpoD | - |
O3139_RS04975 | 996136..996486 | - | 351 | WP_269515872.1 | DUF1428 domain-containing protein | - |
O3139_RS04980 | 996525..996734 | - | 210 | WP_269515873.1 | flagellar hook protein FlgE | - |
O3139_RS04985 | 996731..998407 | - | 1677 | WP_269515874.1 | pilus assembly protein TadG-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14437.58 Da Isoelectric Point: 7.1679
>T266678 WP_269515869.1 NZ_CP114542:993299-993703 [Brevundimonas subvibrioides]
MIRYLLDTNMLSDLVRRPLGGVRQRVALVGEAAVGTSIVVAAEARFGAARASSARLTDQLERILSELVVLPFEAPADRHY
ADVRSALTRAGTPIGANDTLIAAHALALNCILVTDNEREFGRVSGLSIENWLRA
MIRYLLDTNMLSDLVRRPLGGVRQRVALVGEAAVGTSIVVAAEARFGAARASSARLTDQLERILSELVVLPFEAPADRHY
ADVRSALTRAGTPIGANDTLIAAHALALNCILVTDNEREFGRVSGLSIENWLRA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|