Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 869286..869947 | Replicon | chromosome |
| Accession | NZ_CP114542 | ||
| Organism | Brevundimonas subvibrioides strain Br6 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O3139_RS04295 | Protein ID | WP_269515729.1 |
| Coordinates | 869286..869726 (-) | Length | 147 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | O3139_RS04300 | Protein ID | WP_269515730.1 |
| Coordinates | 869723..869947 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3139_RS04255 | 864551..865225 | - | 675 | WP_269515715.1 | bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase | - |
| O3139_RS04260 | 865304..865522 | - | 219 | WP_269515718.1 | hypothetical protein | - |
| O3139_RS04265 | 865522..866115 | - | 594 | WP_269515719.1 | peptide deformylase | - |
| O3139_RS04270 | 866214..866660 | + | 447 | WP_269515721.1 | tol-pal system-associated acyl-CoA thioesterase | - |
| O3139_RS04275 | 866749..867159 | + | 411 | WP_269515723.1 | hypothetical protein | - |
| O3139_RS04280 | 867253..868017 | + | 765 | WP_269515725.1 | protein TolQ | - |
| O3139_RS04285 | 868019..868471 | + | 453 | WP_269515727.1 | ExbD/TolR family protein | - |
| O3139_RS04290 | 868474..869289 | + | 816 | WP_269515728.1 | hypothetical protein | - |
| O3139_RS04295 | 869286..869726 | - | 441 | WP_269515729.1 | PIN domain-containing protein | Toxin |
| O3139_RS04300 | 869723..869947 | - | 225 | WP_269515730.1 | CopG family transcriptional regulator | Antitoxin |
| O3139_RS04305 | 870122..871522 | + | 1401 | WP_269515731.1 | Tol-Pal system beta propeller repeat protein TolB | - |
| O3139_RS04310 | 871606..872160 | + | 555 | WP_269515732.1 | peptidoglycan-associated lipoprotein Pal | - |
| O3139_RS04315 | 872269..873375 | + | 1107 | WP_269515733.1 | DUF3667 domain-containing protein | - |
| O3139_RS04320 | 873421..874278 | + | 858 | WP_269515734.1 | tol-pal system protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 15908.30 Da Isoelectric Point: 6.7489
>T266677 WP_269515729.1 NZ_CP114542:c869726-869286 [Brevundimonas subvibrioides]
MIYLLDANVLIALIDPDHVHSDYAKAWFERTIDEGWATCPITQHAFIRIAGKPSYQMPGTAAAMAEILGRVCQRPGHVFW
PETISLLTSPLVDPARLTSHGQVTDTYLLALAVHNGGKLATFDRRLSTRAVKGGDAALEIIGTLTN
MIYLLDANVLIALIDPDHVHSDYAKAWFERTIDEGWATCPITQHAFIRIAGKPSYQMPGTAAAMAEILGRVCQRPGHVFW
PETISLLTSPLVDPARLTSHGQVTDTYLLALAVHNGGKLATFDRRLSTRAVKGGDAALEIIGTLTN
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|