Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 860085..860635 | Replicon | chromosome |
Accession | NZ_CP114542 | ||
Organism | Brevundimonas subvibrioides strain Br6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O3139_RS04220 | Protein ID | WP_269515705.1 |
Coordinates | 860309..860635 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O3139_RS04215 | Protein ID | WP_269515704.1 |
Coordinates | 860085..860312 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3139_RS04205 | 856695..857843 | - | 1149 | WP_269515701.1 | efflux RND transporter periplasmic adaptor subunit | - |
O3139_RS04210 | 858069..859877 | + | 1809 | WP_269515702.1 | translation elongation factor 4 | - |
O3139_RS04215 | 860085..860312 | + | 228 | WP_269515704.1 | DUF433 domain-containing protein | Antitoxin |
O3139_RS04220 | 860309..860635 | + | 327 | WP_269515705.1 | DUF5615 family PIN-like protein | Toxin |
O3139_RS04225 | 860632..860845 | + | 214 | Protein_836 | elongation factor 4 | - |
O3139_RS04230 | 860847..861566 | + | 720 | WP_269515707.1 | SseB family protein | - |
O3139_RS04235 | 861926..862132 | + | 207 | WP_269515708.1 | hypothetical protein | - |
O3139_RS04240 | 862142..863134 | + | 993 | WP_269515710.1 | HNH endonuclease signature motif containing protein | - |
O3139_RS04245 | 863357..863602 | + | 246 | WP_269515712.1 | hypothetical protein | - |
O3139_RS04250 | 863813..864592 | + | 780 | WP_269515714.1 | hypothetical protein | - |
O3139_RS04255 | 864551..865225 | - | 675 | WP_269515715.1 | bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase | - |
O3139_RS04260 | 865304..865522 | - | 219 | WP_269515718.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11884.57 Da Isoelectric Point: 4.8362
>T266676 WP_269515705.1 NZ_CP114542:860309-860635 [Brevundimonas subvibrioides]
VRIVVDQQLPPLLADWFRDQGIAAIHVRDLGMSAAPDAAIWAEAARDDAVVLSRDEDFVGLTRAGSARLVWIRIGNCANA
TLLAAVEANWPAIRRRLEDGERLVELRS
VRIVVDQQLPPLLADWFRDQGIAAIHVRDLGMSAAPDAAIWAEAARDDAVVLSRDEDFVGLTRAGSARLVWIRIGNCANA
TLLAAVEANWPAIRRRLEDGERLVELRS
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|