Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 506993..507603 | Replicon | chromosome |
Accession | NZ_CP114542 | ||
Organism | Brevundimonas subvibrioides strain Br6 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | O3139_RS02550 | Protein ID | WP_269515338.1 |
Coordinates | 507337..507603 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | O3139_RS02545 | Protein ID | WP_269515337.1 |
Coordinates | 506993..507340 (-) | Length | 116 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3139_RS02515 | 502084..502905 | + | 822 | WP_209322280.1 | enoyl-ACP reductase | - |
O3139_RS02520 | 503334..503507 | + | 174 | WP_209322281.1 | DUF1508 domain-containing protein | - |
O3139_RS02525 | 503504..504025 | - | 522 | WP_269515333.1 | ribosome maturation factor RimM | - |
O3139_RS02530 | 504210..504809 | - | 600 | WP_269515334.1 | 30S ribosomal protein S16 | - |
O3139_RS02535 | 504831..506381 | - | 1551 | WP_269515335.1 | signal recognition particle protein | - |
O3139_RS02540 | 506653..506808 | + | 156 | WP_269515336.1 | hypothetical protein | - |
O3139_RS02545 | 506993..507340 | - | 348 | WP_269515337.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
O3139_RS02550 | 507337..507603 | - | 267 | WP_269515338.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
O3139_RS02555 | 507713..510421 | + | 2709 | WP_269515339.1 | phosphoenolpyruvate carboxylase | - |
O3139_RS02560 | 510418..511020 | - | 603 | WP_269515340.1 | recombination mediator RecR | - |
O3139_RS02565 | 511022..511351 | - | 330 | WP_269515341.1 | YbaB/EbfC family nucleoid-associated protein | - |
O3139_RS02570 | 511490..512101 | + | 612 | WP_269515342.1 | malonic semialdehyde reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 9473.70 Da Isoelectric Point: 11.0117
>T266674 WP_269515338.1 NZ_CP114542:c507603-507337 [Brevundimonas subvibrioides]
VKGKHARTLDAIFADPVRANVAWSDVEALFSAAGGTISEGRGSRVRVSLNAVDAVFHRPHPQKETDKGALKSVRRFLTEA
GHAPDAKR
VKGKHARTLDAIFADPVRANVAWSDVEALFSAAGGTISEGRGSRVRVSLNAVDAVFHRPHPQKETDKGALKSVRRFLTEA
GHAPDAKR
Download Length: 267 bp
Antitoxin
Download Length: 116 a.a. Molecular weight: 12579.10 Da Isoelectric Point: 5.6004
>AT266674 WP_269515337.1 NZ_CP114542:c507340-506993 [Brevundimonas subvibrioides]
MTTMTHDGYLATVELDEAAGLFHGEVINTRDVLTFQGRTPDELKTAFADTIADYLDWCRERGKTPDKPFSGTFSVRVAPE
VHRRAAAAAAREGKSLNGFVAELLDRASLGKHEAV
MTTMTHDGYLATVELDEAAGLFHGEVINTRDVLTFQGRTPDELKTAFADTIADYLDWCRERGKTPDKPFSGTFSVRVAPE
VHRRAAAAAAREGKSLNGFVAELLDRASLGKHEAV
Download Length: 348 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|