Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 4775924..4776566 | Replicon | chromosome |
Accession | NZ_CP114406 | ||
Organism | Bacillus thuringiensis serovar tenebrionis strain NB-176 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | O3S71_RS24680 | Protein ID | WP_000635965.1 |
Coordinates | 4775924..4776274 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | O3S71_RS24685 | Protein ID | WP_000004570.1 |
Coordinates | 4776279..4776566 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3S71_RS24665 | 4772860..4773318 | - | 459 | WP_000343553.1 | SprT family protein | - |
O3S71_RS24670 | 4773514..4773630 | + | 117 | WP_001143640.1 | cortex morphogenetic protein CmpA | - |
O3S71_RS24675 | 4773688..4775856 | - | 2169 | WP_016078972.1 | Tex family protein | - |
O3S71_RS24680 | 4775924..4776274 | - | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
O3S71_RS24685 | 4776279..4776566 | - | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
O3S71_RS24690 | 4776875..4778044 | - | 1170 | WP_000390595.1 | alanine racemase | - |
O3S71_RS24695 | 4778162..4779112 | - | 951 | WP_003306148.1 | outer membrane lipoprotein carrier protein LolA | - |
O3S71_RS24700 | 4779269..4779628 | - | 360 | WP_000583417.1 | holo-ACP synthase | - |
O3S71_RS24705 | 4779722..4780294 | + | 573 | WP_016078971.1 | rhomboid family intramembrane serine protease | - |
O3S71_RS24710 | 4780287..4781249 | - | 963 | WP_016078970.1 | UV DNA damage repair endonuclease UvsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T266662 WP_000635965.1 NZ_CP114406:c4776274-4775924 [Bacillus thuringiensis serovar tenebrionis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10780.36 Da Isoelectric Point: 8.9605
>AT266662 WP_000004570.1 NZ_CP114406:c4776566-4776279 [Bacillus thuringiensis serovar tenebrionis]
VSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLLRQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLA
EYEAAHTVERLVSGG
VSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLLRQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLA
EYEAAHTVERLVSGG
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |