Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2783752..2784730 | Replicon | chromosome |
Accession | NZ_CP114406 | ||
Organism | Bacillus thuringiensis serovar tenebrionis strain NB-176 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | B7IX38 |
Locus tag | O3S71_RS14340 | Protein ID | WP_000624981.1 |
Coordinates | 2783993..2784730 (-) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | B7IX39 |
Locus tag | O3S71_RS14335 | Protein ID | WP_000237817.1 |
Coordinates | 2783752..2783880 (-) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3S71_RS14305 | 2779269..2779520 | + | 252 | WP_000821942.1 | LuxR C-terminal-related transcriptional regulator | - |
O3S71_RS14310 | 2779661..2780266 | - | 606 | WP_000517276.1 | hypothetical protein | - |
O3S71_RS14315 | 2780292..2781101 | - | 810 | WP_016077711.1 | papain-like cysteine protease family protein | - |
O3S71_RS14320 | 2781414..2782883 | - | 1470 | WP_000287540.1 | beta-Ala-His dipeptidase | - |
O3S71_RS14325 | 2783095..2783484 | + | 390 | WP_000712655.1 | YxeA family protein | - |
O3S71_RS14330 | 2783503..2783679 | - | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
O3S71_RS14335 | 2783752..2783880 | - | 129 | WP_000237817.1 | hypothetical protein | Antitoxin |
O3S71_RS14340 | 2783993..2784730 | - | 738 | WP_000624981.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
O3S71_RS14345 | 2784969..2785706 | - | 738 | WP_000594159.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
O3S71_RS14350 | 2785872..2786354 | - | 483 | WP_000191905.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
O3S71_RS14355 | 2786502..2788145 | + | 1644 | WP_016077712.1 | alpha-keto acid decarboxylase family protein | - |
O3S71_RS14360 | 2788303..2789085 | - | 783 | WP_016077713.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28335.09 Da Isoelectric Point: 8.2998
>T266661 WP_000624981.1 NZ_CP114406:c2784730-2783993 [Bacillus thuringiensis serovar tenebrionis]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNVFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6D1SWF1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | B7IX39 |