Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 10877..11613 | Replicon | plasmid pKP0155-1 |
| Accession | NZ_CP114376 | ||
| Organism | Klebsiella pneumoniae strain KP6870155 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | NOZ09_RS26505 | Protein ID | WP_004187044.1 |
| Coordinates | 10877..11359 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NOZ09_RS26510 | Protein ID | WP_003026799.1 |
| Coordinates | 11347..11613 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOZ09_RS26480 | 6903..7839 | - | 937 | Protein_6 | ISNCY family transposase | - |
| NOZ09_RS26485 | 7949..8098 | + | 150 | Protein_7 | transposase | - |
| NOZ09_RS26490 | 8114..8224 | + | 111 | Protein_8 | IS3 family transposase | - |
| NOZ09_RS26495 (NOZ09_005145) | 8456..9160 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| NOZ09_RS26500 | 9320..10666 | - | 1347 | WP_188201154.1 | ISNCY family transposase | - |
| NOZ09_RS26505 (NOZ09_005147) | 10877..11359 | - | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| NOZ09_RS26510 (NOZ09_005148) | 11347..11613 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NOZ09_RS26515 (NOZ09_005149) | 11764..12468 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NOZ09_RS26520 (NOZ09_005150) | 12627..15212 | - | 2586 | WP_087842655.1 | EAL domain-containing protein | - |
| NOZ09_RS26525 | 15181..15426 | - | 246 | WP_032238678.1 | hypothetical protein | - |
| NOZ09_RS26530 (NOZ09_005152) | 15484..16464 | - | 981 | Protein_16 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..67306 | 67306 | |
| - | inside | IScluster/Tn | - | - | 2795..16464 | 13669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T266653 WP_004187044.1 NZ_CP114376:c11359-10877 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|