Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4804064..4804580 | Replicon | chromosome |
Accession | NZ_CP114375 | ||
Organism | Klebsiella pneumoniae strain KP6870155 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A085DK79 |
Locus tag | NOZ09_RS23785 | Protein ID | WP_009309309.1 |
Coordinates | 4804064..4804348 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NOZ09_RS23790 | Protein ID | WP_002886901.1 |
Coordinates | 4804338..4804580 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOZ09_RS23760 (4799548) | 4799548..4799811 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
NOZ09_RS23765 (4799941) | 4799941..4800114 | + | 174 | Protein_4660 | hypothetical protein | - |
NOZ09_RS23770 (4800117) | 4800117..4800860 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NOZ09_RS23775 (4801217) | 4801217..4803355 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NOZ09_RS23780 (4803596) | 4803596..4804060 | + | 465 | WP_032418146.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NOZ09_RS23785 (4804064) | 4804064..4804348 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOZ09_RS23790 (4804338) | 4804338..4804580 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NOZ09_RS23795 (4804658) | 4804658..4806568 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NOZ09_RS23800 (4806591) | 4806591..4807745 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NOZ09_RS23805 (4807812) | 4807812..4808552 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T266651 WP_009309309.1 NZ_CP114375:c4804348-4804064 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085DK79 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |